KEGG   Candidatus Symbiopectobacterium sp. SyEd1: K6K13_06790
Entry
K6K13_06790       CDS       T07463                                 
Name
(GenBank) glycosyltransferase family 2 protein
  KO
K21363  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase [EC:2.4.1.305]
Organism
sym  Candidatus Symbiopectobacterium sp. SyEd1
Brite
KEGG Orthology (KO) [BR:sym00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sym01005]
    K6K13_06790
Enzymes [BR:sym01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.305  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase
     K6K13_06790
Lipopolysaccharide biosynthesis proteins [BR:sym01005]
 O-antigen repeat unit
  K6K13_06790
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Other DBs
NCBI-ProteinID: QZN97076
Position
1445550..1446293
AA seq 247 aa
MSLVSVIMPAHNADATIAESIESVLNQSFPDFELIICDDGSTDNTNAIIKKYSDIDKRII
LIESFMSRGAAETRNLCILKSRFKFICFLDSDDLWEKDKLASQVSFMQENNLAMTHGKYK
MFDGGGLNKKIIPPKVISYSDLLRKCDIGCLTVMLDSEKIDSIRFPNVVKEDYALWLLIM
RNGFSSYLYPGCEAYYRRRAGSVSSSKIKEIKKQLHVLKYVADISFSKRCFYILTYCVNG
CIKHFYH
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtctttagtcagtgtaattatgcctgctcataatgctgatgccacaatagctgagtcc
atagagtccgttttaaatcaatcttttcctgattttgagttgattatatgtgatgatggt
tctactgataatacaaacgcaataattaagaagtattcagatattgataaaagaattatt
ttaattgagagttttatgtctcgaggtgctgctgaaacaagaaatttgtgtattttaaag
tcaaggttcaaatttatatgttttcttgacagcgatgacctttgggaaaaagataagttg
gcttctcaagtatcttttatgcaagaaaataacctggctatgacccatggtaaatataaa
atgtttgatggtggtggacttaataaaaaaataatcccgcctaaagtaatatcgtattca
gacttactcaggaaatgtgatattggatgtcttacggtaatgttagattctgaaaaaata
gattctatacgttttcctaatgttgttaaagaggattatgctttatggttgctaatcatg
aggaatggtttttcttcatatttgtatccagggtgtgaagcatattatagaagacgggcc
ggatcagtatcttcatcaaaaataaaggaaattaaaaagcaattgcatgtgcttaaatat
gttgcggatatatcattttctaaacgatgtttttatatacttacatattgcgttaatggt
tgcattaagcatttttaccactag

DBGET integrated database retrieval system