KEGG   Tachyglossus aculeatus (Australian echidna): 119939968
Entry
119939968         CDS       T10703                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tacu  Tachyglossus aculeatus (Australian echidna)
Pathway
tacu01521  EGFR tyrosine kinase inhibitor resistance
tacu01522  Endocrine resistance
tacu01524  Platinum drug resistance
tacu04012  ErbB signaling pathway
tacu04014  Ras signaling pathway
tacu04015  Rap1 signaling pathway
tacu04024  cAMP signaling pathway
tacu04062  Chemokine signaling pathway
tacu04066  HIF-1 signaling pathway
tacu04068  FoxO signaling pathway
tacu04070  Phosphatidylinositol signaling system
tacu04071  Sphingolipid signaling pathway
tacu04072  Phospholipase D signaling pathway
tacu04081  Hormone signaling
tacu04140  Autophagy - animal
tacu04145  Phagocytosis
tacu04150  mTOR signaling pathway
tacu04151  PI3K-Akt signaling pathway
tacu04152  AMPK signaling pathway
tacu04210  Apoptosis
tacu04211  Longevity regulating pathway
tacu04213  Longevity regulating pathway - multiple species
tacu04218  Cellular senescence
tacu04360  Axon guidance
tacu04370  VEGF signaling pathway
tacu04380  Osteoclast differentiation
tacu04510  Focal adhesion
tacu04517  IgSF CAM signaling
tacu04518  Integrin signaling
tacu04550  Signaling pathways regulating pluripotency of stem cells
tacu04611  Platelet activation
tacu04613  Neutrophil extracellular trap formation
tacu04620  Toll-like receptor signaling pathway
tacu04625  C-type lectin receptor signaling pathway
tacu04630  JAK-STAT signaling pathway
tacu04650  Natural killer cell mediated cytotoxicity
tacu04660  T cell receptor signaling pathway
tacu04662  B cell receptor signaling pathway
tacu04664  Fc epsilon RI signaling pathway
tacu04666  Fc gamma R-mediated phagosome formation
tacu04668  TNF signaling pathway
tacu04670  Leukocyte transendothelial migration
tacu04722  Neurotrophin signaling pathway
tacu04725  Cholinergic synapse
tacu04750  Inflammatory mediator regulation of TRP channels
tacu04810  Regulation of actin cytoskeleton
tacu04910  Insulin signaling pathway
tacu04914  Progesterone-mediated oocyte maturation
tacu04915  Estrogen signaling pathway
tacu04917  Prolactin signaling pathway
tacu04919  Thyroid hormone signaling pathway
tacu04923  Regulation of lipolysis in adipocytes
tacu04926  Relaxin signaling pathway
tacu04929  GnRH secretion
tacu04930  Type II diabetes mellitus
tacu04931  Insulin resistance
tacu04932  Non-alcoholic fatty liver disease
tacu04933  AGE-RAGE signaling pathway in diabetic complications
tacu04935  Growth hormone synthesis, secretion and action
tacu04960  Aldosterone-regulated sodium reabsorption
tacu04973  Carbohydrate digestion and absorption
tacu05010  Alzheimer disease
tacu05017  Spinocerebellar ataxia
tacu05020  Prion disease
tacu05100  Bacterial invasion of epithelial cells
tacu05135  Yersinia infection
tacu05142  Chagas disease
tacu05146  Amoebiasis
tacu05160  Hepatitis C
tacu05161  Hepatitis B
tacu05162  Measles
tacu05163  Human cytomegalovirus infection
tacu05164  Influenza A
tacu05165  Human papillomavirus infection
tacu05166  Human T-cell leukemia virus 1 infection
tacu05167  Kaposi sarcoma-associated herpesvirus infection
tacu05168  Herpes simplex virus 1 infection
tacu05169  Epstein-Barr virus infection
tacu05170  Human immunodeficiency virus 1 infection
tacu05171  Coronavirus disease
tacu05200  Pathways in cancer
tacu05203  Viral carcinogenesis
tacu05205  Proteoglycans in cancer
tacu05206  MicroRNAs in cancer
tacu05207  Chemical carcinogenesis - receptor activation
tacu05208  Chemical carcinogenesis - reactive oxygen species
tacu05210  Colorectal cancer
tacu05211  Renal cell carcinoma
tacu05212  Pancreatic cancer
tacu05213  Endometrial cancer
tacu05214  Glioma
tacu05215  Prostate cancer
tacu05218  Melanoma
tacu05220  Chronic myeloid leukemia
tacu05221  Acute myeloid leukemia
tacu05222  Small cell lung cancer
tacu05223  Non-small cell lung cancer
tacu05224  Breast cancer
tacu05225  Hepatocellular carcinoma
tacu05226  Gastric cancer
tacu05230  Central carbon metabolism in cancer
tacu05231  Choline metabolism in cancer
tacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tacu05415  Diabetic cardiomyopathy
tacu05417  Lipid and atherosclerosis
tacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    119939968
   04014 Ras signaling pathway
    119939968
   04015 Rap1 signaling pathway
    119939968
   04370 VEGF signaling pathway
    119939968
   04630 JAK-STAT signaling pathway
    119939968
   04668 TNF signaling pathway
    119939968
   04066 HIF-1 signaling pathway
    119939968
   04068 FoxO signaling pathway
    119939968
   04070 Phosphatidylinositol signaling system
    119939968
   04072 Phospholipase D signaling pathway
    119939968
   04071 Sphingolipid signaling pathway
    119939968
   04024 cAMP signaling pathway
    119939968
   04151 PI3K-Akt signaling pathway
    119939968
   04152 AMPK signaling pathway
    119939968
   04150 mTOR signaling pathway
    119939968
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    119939968
   04517 IgSF CAM signaling
    119939968
   04518 Integrin signaling
    119939968
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagocytosis
    119939968
   04140 Autophagy - animal
    119939968
  09143 Cell growth and death
   04210 Apoptosis
    119939968
   04218 Cellular senescence
    119939968
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    119939968
   04550 Signaling pathways regulating pluripotency of stem cells
    119939968
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119939968
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    119939968
   04613 Neutrophil extracellular trap formation
    119939968
   04620 Toll-like receptor signaling pathway
    119939968
   04625 C-type lectin receptor signaling pathway
    119939968
   04650 Natural killer cell mediated cytotoxicity
    119939968
   04660 T cell receptor signaling pathway
    119939968
   04662 B cell receptor signaling pathway
    119939968
   04664 Fc epsilon RI signaling pathway
    119939968
   04666 Fc gamma R-mediated phagosome formation
    119939968
   04670 Leukocyte transendothelial migration
    119939968
   04062 Chemokine signaling pathway
    119939968
  09152 Endocrine system
   04910 Insulin signaling pathway
    119939968
   04923 Regulation of lipolysis in adipocytes
    119939968
   04929 GnRH secretion
    119939968
   04915 Estrogen signaling pathway
    119939968
   04914 Progesterone-mediated oocyte maturation
    119939968
   04917 Prolactin signaling pathway
    119939968
   04926 Relaxin signaling pathway
    119939968
   04935 Growth hormone synthesis, secretion and action
    119939968
   04919 Thyroid hormone signaling pathway
    119939968
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    119939968
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    119939968
  09156 Nervous system
   04725 Cholinergic synapse
    119939968
   04722 Neurotrophin signaling pathway
    119939968
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    119939968
  09158 Development and regeneration
   04360 Axon guidance
    119939968
   04380 Osteoclast differentiation
    119939968
  09149 Aging
   04211 Longevity regulating pathway
    119939968
   04213 Longevity regulating pathway - multiple species
    119939968
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119939968
   05206 MicroRNAs in cancer
    119939968
   05205 Proteoglycans in cancer
    119939968
   05207 Chemical carcinogenesis - receptor activation
    119939968
   05208 Chemical carcinogenesis - reactive oxygen species
    119939968
   05203 Viral carcinogenesis
    119939968
   05230 Central carbon metabolism in cancer
    119939968
   05231 Choline metabolism in cancer
    119939968
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    119939968
  09162 Cancer: specific types
   05210 Colorectal cancer
    119939968
   05212 Pancreatic cancer
    119939968
   05225 Hepatocellular carcinoma
    119939968
   05226 Gastric cancer
    119939968
   05214 Glioma
    119939968
   05221 Acute myeloid leukemia
    119939968
   05220 Chronic myeloid leukemia
    119939968
   05218 Melanoma
    119939968
   05211 Renal cell carcinoma
    119939968
   05215 Prostate cancer
    119939968
   05213 Endometrial cancer
    119939968
   05224 Breast cancer
    119939968
   05222 Small cell lung cancer
    119939968
   05223 Non-small cell lung cancer
    119939968
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    119939968
   05170 Human immunodeficiency virus 1 infection
    119939968
   05161 Hepatitis B
    119939968
   05160 Hepatitis C
    119939968
   05171 Coronavirus disease
    119939968
   05164 Influenza A
    119939968
   05162 Measles
    119939968
   05168 Herpes simplex virus 1 infection
    119939968
   05163 Human cytomegalovirus infection
    119939968
   05167 Kaposi sarcoma-associated herpesvirus infection
    119939968
   05169 Epstein-Barr virus infection
    119939968
   05165 Human papillomavirus infection
    119939968
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    119939968
   05100 Bacterial invasion of epithelial cells
    119939968
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    119939968
   05142 Chagas disease
    119939968
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119939968
   05017 Spinocerebellar ataxia
    119939968
   05020 Prion disease
    119939968
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119939968
   05418 Fluid shear stress and atherosclerosis
    119939968
   05415 Diabetic cardiomyopathy
    119939968
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    119939968
   04932 Non-alcoholic fatty liver disease
    119939968
   04931 Insulin resistance
    119939968
   04933 AGE-RAGE signaling pathway in diabetic complications
    119939968
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    119939968
   01524 Platinum drug resistance
    119939968
   01522 Endocrine resistance
    119939968
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tacu04131]
    119939968
Membrane trafficking [BR:tacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    119939968
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH2_1 ODF2_C CCDC113_CCDC96_CC
Other DBs
NCBI-GeneID: 119939968
NCBI-ProteinID: XP_038615945
Position
18:complement(38442793..38560577)
AA seq 462 aa
MYNTVWNMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTPSSTNEVKDSAAVA
LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRD
GKYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDSIDAVGK
KLQEYHAQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKE
YIERFRREGNEKEIERIMMNYEKLKSRLGEIHESKMRLEQDLKKQALDNREIDKKMNSIK
PDLIQLRKIRDQYLVWLNHKGVRQKRLNDWLGIQNENRDDTYFVNEEDENLPHYDEKTWF
VGDLNRTQAEDLLRGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTPRGYGFAEPY
NLYGTLKELVLHYQQTSLVQHNDSLNVRLAYPVYAQMPALGR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtacaatacagtgtggaatatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattccacggaactgatattttatattgaaatggaccctccagctcttcctcccaaa
ccgcccaagccaatgactccgtcaagcacaaatgaggtcaaggacagtgctgctgtagcc
ctccaggatgccgagtggtactggggggacatttccagggaggaggtgaacgacaaatta
cgagacatgccggatgggactttcttggtgcgcgatgcatccacgaagatgcagggagac
tacactttgacactgaggaagggaggcaataataagctgataaagatctatcaccgggat
ggtaaatatggtttttcggatccgctgacgtttaattctgtggtggagctcatcaaccac
taccgccatgaatcccttgctcagtacaatcccaaactcgatgtgaagctgatgtatcca
gtatccagatatcaacaggatcagttggtgaaggaagatagcatcgacgccgtggggaag
aagcttcaggagtaccacgctcagtaccaggagaagagcaaggagtacgaccgcctgtac
gaggagtacaccagaacctctcaggaaattcagatgaagaggacggcaattgaagctttt
aatgaaacaattaaaatatttgaagagcagtgccacacccaggagcggtacagcaaagaa
tacatcgagcgatttcgtcgcgaggggaacgagaaggaaatcgaacggattatgatgaac
tacgagaaattgaagtcccgactgggagagatccacgagagcaaaatgcggctggagcag
gacctgaagaaacaagctttggacaaccgggaaatcgataaaaaaatgaacagcatcaag
ccagacctcattcagctgcgcaagatccgagaccagtacctggtctggcttaaccacaaa
ggcgtcaggcagaagcggctcaacgactggctgggaatccagaacgagaacagagacgac
acttactttgtgaacgaggaggacgagaacctgccccactacgacgagaaaacctggttc
gtcggggatctcaaccgcacccaggcggaggacttgctgcgcgggaaacccgacggggcc
ttcctaatccgcgagagcagcaagaaaggatgctacgcctgctccgtggtggccgacggc
gaagtgaagcactgcgtcatctacagcaccccgcgcggctacgggttcgccgagccctac
aacctgtacggcaccctcaaggagctcgtcctccattaccagcagacgtccctggtccaa
cacaacgattccctcaacgtccggctcgcctaccccgtctacgcacagatgcccgccctc
ggcagataa

DBGET integrated database retrieval system