KEGG   Thermosipho africanus: THA_298
Entry
THA_298           CDS       T00797                                 

Definition
(GenBank) D-alanine-D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
taf  Thermosipho africanus
Pathway
taf00473  D-Alanine metabolism
taf00550  Peptidoglycan biosynthesis
taf01100  Metabolic pathways
taf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    THA_298
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THA_298
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    THA_298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:taf01011]
    THA_298
Enzymes [BR:taf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     THA_298
Peptidoglycan biosynthesis and degradation proteins [BR:taf01011]
 Precursor biosynthesis
  Amino acid ligase
   THA_298
SSDB
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A DNA_primase_lrg
Other DBs
NCBI-ProteinID: ACJ74798
UniProt: B7IFD4
Position
complement(297771..298709)
AA seq 312 aa
MKIAIVCDKNINDEEKRMVEAVKNAVSKKYDCEVVQFDENFINKIKGFDFVFNLSNKGGK
ETIQVHVPALLDLLNIPYTSSNAYSHSLCLDKITTKIIMQHYNIPTPRFYVYDLGQTPEK
IDNGTFIVKPPREGSARGISKDSVVDNLKALQKMVKYIHEEFKQPALVEEFIDGKELSVG
IIGNGDSLEVLPILEIDFSTLPEGLERFYSYNVKHNYGEMTNYICPARISNNVKEKLEFY
AKKLFRVLNLRDYARMDVRIRDDEIYFLEVNSAPQLVPVYSDITKMAKAAGYEYDDLILK
ILEISMERWELK
NT seq 939 nt   +upstreamnt  +downstreamnt
gtgaagatagcaattgtttgtgataagaatatcaatgatgaagaaaaaagaatggttgag
gcggtaaaaaatgcagtgtctaaaaaatatgattgtgaagtagtacaatttgatgagaat
tttatcaataaaataaaaggttttgattttgtgtttaacctttcaaataagggtggaaag
gaaacaatacaagttcatgttcctgctctcctagatttgttaaatattccatacacttct
tcaaatgcatattcacattcattatgtcttgataaaataactactaagataattatgcaa
cattataacattccaacaccaagattttatgtatatgatctaggacaaactccagaaaaa
atagataatggcacctttatagtaaagccaccacgtgagggaagtgcacgtggtatttca
aaagatagcgtagttgataatttaaaagctctacaaaaaatggtaaagtatatacatgaa
gagtttaaacaaccagcacttgtagaagaatttattgatggtaaagagttaagtgttggt
ataataggaaatggggatagtttagaagttttgccaattttggagatagatttttcgacc
ctgccagaaggacttgaaagattttattcttacaatgtaaagcataattatggtgagatg
actaattatatatgccctgcaagaatttcaaataatgtaaaagaaaaacttgaattttat
gctaaaaaactttttagagtattaaatcttagagactatgcaagaatggatgttagaatt
agggatgatgagatatacttcttggaagttaattcagctcctcagcttgttccagtatat
tcagacataacaaaaatggcgaaagctgcaggatatgaatatgatgatttaattttgaaa
attttagaaatatcaatggaaaggtgggaacttaaatga

KEGG   Thermosipho africanus: THA_792
Entry
THA_792           CDS       T00797                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
taf  Thermosipho africanus
Pathway
taf00473  D-Alanine metabolism
taf00550  Peptidoglycan biosynthesis
taf01100  Metabolic pathways
taf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    THA_792
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THA_792
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    THA_792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:taf01011]
    THA_792
Enzymes [BR:taf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     THA_792
Peptidoglycan biosynthesis and degradation proteins [BR:taf01011]
 Precursor biosynthesis
  Amino acid ligase
   THA_792
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_YheCD DUF2112 DUF3042
Other DBs
NCBI-ProteinID: ACJ75254
UniProt: B7IGP0
Position
complement(806137..807240)
AA seq 367 aa
MINVGLLFGSKSVEHEISIITAHQVLSFVDKNKYNIIPIYITKDGKWLTGKILEDLENFK
NLERLEKKSKQISSISAKDGKLILHSNIKKITIDVCLLTFHGSNGEDGSIQGMLEFLNVP
YTGCGMYSSMYTMDKVITKLILKEKNIPVVDFLYTNKKNYTNDFLNHCKEVLEYPMIVKP
ARLGSSIGVKKVNDKCELEEAIETAFSFDDKVIVEKWIDSRELNCAVMGYKNIVVSEIEE
IKKQKDFFDYNEKYVQKGKKFSNHIIPAPIDENLKNTIKSIARDTFNALECHGNIRIDFL
LSKDNKIYVNEVNSIPGALSYYLWQMSGFTFSQVIDNMISIAFEAFKDKKSKIYSIDTNL
FDLKVEK
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgataaacgttggattactctttggttcaaaaagtgtagagcacgagatctctataata
acagcacatcaagtgctgagttttgttgataaaaataaatacaatataattcctatatat
attactaaagatggaaaatggctaacgggaaagattctcgaagaccttgaaaattttaaa
aatcttgaaagacttgaaaaaaaatcaaaacaaatttcatctatctctgcaaaagatgga
aaattaatcttacatagcaatataaaaaaaattactatcgatgtctgtcttttaacattt
cacggaagcaacggtgaggatggtagcattcaaggaatgctagaatttttaaatgttcct
tatacaggttgtggaatgtactcttcaatgtacacaatggataaagttataacaaaactt
attttaaaagaaaaaaatattcctgtagttgattttctatacacaaacaaaaaaaattac
acaaatgactttttaaatcattgtaaagaagttcttgaatatccaatgatagttaagcct
gcaaggcttggttcaagtattggagtaaaaaaagtaaatgataaatgcgagctagaagaa
gcaattgaaactgctttttctttcgatgacaaagttatagttgaaaagtggatagattct
agagagttaaattgtgcagtaatgggatataaaaacatagttgtatcagaaatagaagaa
ataaaaaaacaaaaagatttttttgattacaacgaaaaatacgttcaaaaaggtaaaaaa
ttttcaaatcatataattcccgcaccaatagatgaaaatttaaaaaataccataaaatct
atagcgcgtgatacatttaatgcactggaatgtcatggaaatataagaattgactttttg
ctatctaaagataataaaatatacgttaacgaagttaatagcattcctggagcactttca
tactatctatggcaaatgagcggtttcacattttctcaggtaattgataacatgatttca
attgcttttgaagcttttaaagacaaaaaatccaaaatatactccatagataccaatcta
ttcgacttaaaggtggaaaaatga

DBGET integrated database retrieval system