KEGG   Thermococcus barophilus: TERMP_01545
Entry
TERMP_01545       CDS       T01377                                 

Name
(GenBank) ribokinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tba  Thermococcus barophilus
Brite
KEGG Orthology (KO) [BR:tba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TERMP_01545
Enzymes [BR:tba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TERMP_01545
SSDB
Motif
Pfam: PfkB KIND
Other DBs
NCBI-ProteinID: ADT84520
UniProt: F0LIR8
Position
1334902..1335891
AA seq 329 aa
MHPVERLNCSLILTENGENLKAFQCATYEIKPTGGMAMFDVVAIGNLNYDIIMLVDRFPE
FHEKIPAKNAHFGLGGAAGNTATWLANMGLRVGFIGAVGKDEIGEAHINFFKKIGIDTKG
IKIVDVPSGVAVAIIKGEDKRIVKYLGANKYRELDYEYLSKTKHIHLSSNPEKLIIDTVN
FAYEHGITVSLDIGEAKIPEEIEEKITYLLMNEDEFKRKFGNLDKISEVKAKNVIVTLNG
GGALVRDEKGNIFEVKGLSAEVVDSTGAGDSFDAGLIYGVLKGWSLRDAAKLGMLLAYLT
VQKVGARSAVIPLEEIKKRAEELNLNLPF
NT seq 990 nt   +upstreamnt  +downstreamnt
ttgcacccagtagaaagactaaactgttctctgatattaacagaaaatggagaaaacctt
aaagcttttcagtgtgcaacatatgaaataaaacccaccggagggatggcaatgtttgac
gtggttgcaatagggaacctcaactacgacataataatgctcgttgaccgctttccggaa
ttccatgaaaagattccagcaaaaaatgcccactttggacttggaggagccgctggaaac
acagcaacatggttagccaatatgggccttagagtggggttcataggggctgtaggaaaa
gacgaaattggagaagcacacataaacttcttcaaaaagattggtattgacaccaaaggc
ataaaaattgttgatgttccttcaggtgttgccgtggcaataataaagggcgaagataag
agaattgtaaaatacttaggagccaacaaatacagagagcttgactatgaatatctatcc
aaaacaaaacacatccatctatcttccaatccagaaaagctcatcatcgacacagtaaac
tttgcttatgaacacggaattacagtctcacttgacattggggaggcaaaaatcccagaa
gaaatcgaggaaaaaataacatatcttctcatgaacgaggacgaatttaagaggaaattc
gggaacctggataaaatcagcgaggtcaaagccaaaaatgtgattgtaacactgaacgga
gggggagcattggtaagggacgaaaaaggaaacatatttgaggttaaaggactcagcgct
gaagtcgttgattccactggagcgggagactcctttgatgctgggctcatttatggggtt
ctcaaagggtggagtttaagagatgccgcaaagcttggaatgctcctggcttatctaact
gttcagaaagttggtgcaagaagtgcagtaattccccttgaagagataaaaaagagagcg
gaagagctgaatctcaacctgcctttctaa

DBGET integrated database retrieval system