KEGG   Thiobacillus denitrificans: Tbd_0914
Entry
Tbd_0914          CDS       T00275                                 

Definition
(GenBank) hypothetical protein containing twin-arginine translocation pathway signal
  KO
K24299  thiocyanate desulfurase [EC:1.8.2.7]
Organism
tbd  Thiobacillus denitrificans
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tbd_0914
Enzymes [BR:tbd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.2  With a cytochrome as acceptor
    1.8.2.7  thiocyanate desulfurase
     Tbd_0914
Motif
Pfam: TAT_signal
Other DBs
NCBI-ProteinID: AAZ96867
UniProt: Q3SKC0
Position
969862..971328
AA seq 488 aa
MSINRRQFMKNAIAAGMAGTATMLGSRSAFSAVHDPVGEAQADLFRKFKGNVVLLPSKYG
GYVQAMDLSTPETLAWYSYGLHGIDMPIPHHIAAMPSKDPYKGFDFYQTMQPPAAPYVNE
NSPEWRNRGDFKMFKMRYDGSGKQNSITVVNDIGETTGMSLGVHVSIGVGENANKYVAFA
DGQKDMVLITDIGDNPKIVKAFRADYDPVARQLNISHVFPDSTTGKFDYVGRKGMKTSHE
AMLGEELMPADPTAVFVDAFTWHPTLPFGAILIRRLGCCAIVDTRTWEVVSLLSTAKGSP
DNFPLVKQTGFTWTFAVPSVLTPLHEAGFVTSGEYFVACNNVLQNNIAVYRSTDENPNKW
KKETFVEGFGTKYLPLHMGNVPDSRFAFFTMWARKPNNGYICKVDTKTWKVVAKWDTGPD
PHTCDCTVDGKYMTTVYSGHQAGQSGLVVINIANDKIEARLPCPGGMHDHVVVPESWEGL
KYSRSTSV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgagcatcaacagaaggcagttcatgaagaacgcgatcgccgccggcatggcgggaacc
gcgacgatgctgggatcgcgcagcgcgttttcggcggtccacgacccggttggcgaggca
caggccgacctgttcaggaaattcaagggcaacgtcgtgctgttgccgagcaagtacggc
ggctacgtgcaggcaatggacctgtcgacgccggaaacgctggcctggtattcctacggc
ctgcatggcatcgacatgccgattccccaccacatcgctgccatgccgtcgaaggacccc
tacaagggcttcgacttctaccagacgatgcagccgccggcggcgccctacgtcaacgag
aactcgcccgagtggcgcaaccgcggcgacttcaagatgttcaagatgcgctacgacggc
agcggcaagcagaactcgatcacggtcgtcaacgacatcggcgaaaccaccggcatgtcg
ctcggcgtgcacgtgtcgatcggtgtcggtgaaaacgcgaacaagtacgtcgccttcgcc
gacggccagaaggacatggtgctgatcaccgacatcggcgacaacccgaagatcgtcaag
gccttccgcgccgactacgatcccgtcgcgcgccagctcaacatcagccacgtcttcccc
gattcgacgaccggcaagttcgactacgtcgggcgcaagggcatgaagacgtcgcatgag
gcgatgctcggcgaggaactgatgccggccgacccgaccgcggtcttcgtcgacgcgttc
acttggcatccgacgctgccgttcggtgcgatcctgatccgccgtctcggctgctgcgcg
atcgtcgacacgcggacctgggaagtcgtctcgctgctgtcgaccgccaagggctcgccc
gacaacttcccgctcgtcaagcagacggggttcacctggaccttcgcggtgccgtcggtg
ctgacgccgctgcacgaggcgggattcgtcaccagcggggagtatttcgtcgcctgcaac
aacgtgctgcagaacaacatcgcggtctaccgctcgaccgacgaaaaccccaacaagtgg
aagaaggagaccttcgtcgaaggcttcggcaccaagtacctgccgctgcacatgggcaac
gtgccggattcgcgcttcgccttcttcacgatgtgggcgcgcaaacccaacaacggctac
atctgcaaggtcgacaccaagacctggaaagtcgtcgccaagtgggataccggtcctgat
ccgcacacctgcgactgcaccgtcgacggcaagtacatgaccaccgtgtacagcgggcac
caggccggtcagtcgggcctcgtggtgatcaacatcgccaacgacaagatcgaggcgcgt
ctgccgtgtccgggcggcatgcacgaccacgtcgtcgttcccgaaagctgggaaggcctg
aagtactcgcgcagcacctcggtgtaa

DBGET integrated database retrieval system