KEGG   Trypanosoma brucei gambiense: TbgDal_VIII1645
Entry
TbgDal_VIII1645   CDS       T06526                                 

Name
(RefSeq) tryparedoxin peroxidase
  KO
K11186  mitochondrial tryparedoxin peroxidase, trypanosomatid typical 2-Cys peroxiredoxin [EC:1.11.1.-]
Organism
tbg  Trypanosoma brucei gambiense
Pathway
tbg00480  Glutathione metabolism
tbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TbgDal_VIII1645
Enzymes [BR:tbg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     TbgDal_VIII1645
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-GeneID: 23863328
NCBI-ProteinID: XP_011775492
UniProt: C9ZUX7
Position
8:485306..485986
AA seq 226 aa
MLRRFSMLPLSGGIARRSFFRTAPLFNLDYQAYRTATVREAAPEFAGKAVVDGKIKDISM
NDYKGKYIVLFFYPLDFTFVCPTEIVSFSDSHAEFEKLNTQVIAVSCDSHFSHLAWVETP
RKKGGLGEMKIPLLSDFTKEISRDYGVLVEEQGLSLRALFVIDDKGILRHVTINDLPVGR
NVDEVLRVVQAFQYADKTGDVIPCNWKPGKETMKVEAAKEYFEKNL
NT seq 681 nt   +upstreamnt  +downstreamnt
atgcttcgccgtttctccatgttgccattatctggtggcattgcccgccgctccttcttc
cggacggcaccactgtttaacctcgactatcaggcataccgaacagctactgtacgcgaa
gcagcgcctgagttcgctggaaaggctgtggtggacggaaagatcaaggacatcagcatg
aacgactacaagggaaaatatattgttctctttttctaccctcttgacttcacgtttgtc
tgcccaacggaaattgtttccttctcagattctcacgctgagtttgaaaaactgaacacg
caagtcatagccgtgtcctgtgacagtcacttttcacatctcgcgtgggttgaaactccc
cgaaaaaaggggggtctgggagaaatgaagattcccttgctatccgacttcacaaaggag
atatctcgggactatggggtgttggtcgaagaacagggactttcactgcgcgctttgttc
gtcattgatgacaaagggattcttcgccatgtgaccatcaacgatttgcccgtcggtcgg
aatgttgacgaggtgctccgcgtcgtgcaagcgttccaatacgccgataagactggcgac
gttattccttgcaactggaagccagggaaggagacgatgaaggtggaagcagcgaaggaa
tactttgagaagaatctatag

DBGET integrated database retrieval system