KEGG   Trypanosoma brucei brucei: Tb927.8.1990
Entry
Tb927.8.1990      CDS       T01013                                 

Name
(RefSeq) tryparedoxin peroxidase
  KO
K11186  mitochondrial tryparedoxin peroxidase, trypanosomatid typical 2-Cys peroxiredoxin [EC:1.11.1.-]
Organism
tbr  Trypanosoma brucei brucei
Pathway
tbr00480  Glutathione metabolism
tbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tb927.8.1990
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     Tb927.8.1990
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-GeneID: 3659187
NCBI-ProteinID: XP_847032
UniProt: D6XKT6
Position
8:634173..634853
AA seq 226 aa
MLRRFSMLPLSGGIARRSFFRTAPLFNLDYQAYRTATVREAAPEFAGKAVVDGKIKDISM
NDYKGKYIVLFFYPLDFTFVCPTEIVSFSDSHAEFEKLNTQVIAVSCDSHFSHLAWVETP
RKKGGLGEMKIPLLSDFTKEISRDYGVLVEEQGLSLRALFVIDDKGILRHVTINDLPVGR
NVDEVLRVVQAFQYADKTGDVIPCNWKPGKETMKVEAAKEYFEKNL
NT seq 681 nt   +upstreamnt  +downstreamnt
atgcttcgccgtttctccatgttgccattatctggtggcattgcccgccgctccttcttc
cggacggcaccactgtttaacctcgactatcaggcataccgaacagctactgtacgcgaa
gcagcgcctgagttcgctggaaaggctgtggtggacggaaagatcaaggacatcagcatg
aacgactacaagggaaaatatattgttctctttttctaccctcttgacttcacgtttgtc
tgcccaacggaaattgtttccttctcagattctcacgctgagtttgaaaaactgaacacg
caagtcatagccgtgtcctgtgacagtcacttttcacatctcgcgtgggttgaaactccc
cgaaaaaaggggggtctgggagaaatgaagattcccttgctatccgacttcacaaaggag
atatctcgggactatggggtgttggtcgaagaacagggactttcactgcgcgctttgttc
gtcattgatgacaaagggattcttcgccatgtgaccatcaacgatttgcccgtcggtcgg
aatgttgacgaggtgctccgcgtcgtgcaagcgttccaatacgccgataagactggcgac
gttattccttgcaactggaagccagggaaggagacgatgaaggtggaagcagcgaaggaa
tactttgagaagaatctatag

DBGET integrated database retrieval system