KEGG   Thermococcus celer: A3L02_00995
Entry
A3L02_00995       CDS       T05076                                 

Definition
(GenBank) RNA 3'-terminal-phosphate cyclase
  KO
K18105  RNA 3'-terminal phosphate cyclase (GTP) [EC:6.5.1.5]
Organism
tce  Thermococcus celer
Brite
KEGG Orthology (KO) [BR:tce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3L02_00995
Enzymes [BR:tce01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.5  RNA 3'-terminal-phosphate cyclase (GTP)
     A3L02_00995
SSDB
Motif
Pfam: RTC RTC_insert
Other DBs
NCBI-ProteinID: ASI98242
UniProt: A0A218NZZ9
Position
complement(167542..168576)
AA seq 344 aa
MEWVEIDGSYGEGGGQILRTAVALSVITGRPVRITRIRANRSNPGLRPQHLHGIVALKEL
SNARVKGAQVGSTYLEFVPGDARPKHVRVPIKTAGSVTLVLQALLPAMAFTGGSFEVTGG
TDVPWSPPVDYLKNVTLHALERMGLRVELEVRRRGHYPKGGGLVVGRVEPWEERRPLIAL
EWRRIERFSGISHATNLPSHVAERQAKAAEERLGELYNVPVEIEREVSRSLGPGSGVVVW
AETDGLRLGGDALGKRGKPAEVVGREAADELVEALTPGKAVDRFLGDQLIPFLAFAGGEI
GVSEITSHLATNVWVVERFLGRTFEVEGDVGEPGVVRVVRRAGV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggagtgggttgagatagacggttcctacggcgagggcggtgggcagatactgagaacg
gcggtcgccctttcggtcatcacgggaaggccggttcggataacccgaatacgggccaac
cgctccaacccgggtctgaggccccagcacctccacggaatcgtggccctgaaggagctg
agcaacgcgagggttaaaggagctcaggtcggttccacctatctggagttcgtccccggg
gatgcccgaccgaagcacgtcagggtcccgataaagaccgccggcagtgtaacgctcgtc
cttcaggctctgcttccggcgatggcattcaccggcgggagcttcgaggtaaccggcggc
accgacgttccctggagtccacccgtggactacctgaagaacgtaaccctccacgccctt
gaacggatgggccttagggttgagctcgaggtaaggcggcgcggtcactacccgaagggc
ggcgggcttgtagttggtagggtcgagccgtgggaggagaggagaccgctcatagccctt
gagtggaggaggatagagcgcttctccggtataagccacgcgacaaacctaccttcccac
gttgccgagaggcaggcaaaagcggccgaggagaggctcggggagctctacaacgttccc
gtggagatcgagagggaggtctcgcgctcgctcgggccggggagcggcgtagtcgtgtgg
gccgagacggatggtctgaggctcggaggcgacgccctcggaaaacggggaaaacccgct
gaagtcgtcgggagggaagcggcggacgagcttgtggaggcactgacgcccggaaaagcc
gtcgataggttcctcggcgaccagctgataccgttcctggccttcgcgggcggggaaatc
ggggtttcggagataacgagccacctcgccaccaacgtctgggtcgtggagcgctttctg
gggagaaccttcgaggtggagggtgacgtcggagagccgggggtcgtgagggtggtgagg
agggctggggtttag

DBGET integrated database retrieval system