KEGG   Thermococcus chitonophagus: CHITON_2127
Entry
CHITON_2127       CDS       T04536                                 

Name
(GenBank) Ribokinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tch  Thermococcus chitonophagus
Brite
KEGG Orthology (KO) [BR:tch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHITON_2127
Enzymes [BR:tch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     CHITON_2127
SSDB
Motif
Pfam: PfkB LPG_synthase_C
Other DBs
NCBI-ProteinID: CUX78906
UniProt: A0A170T0Z7
Position
I:1944563..1945444
AA seq 293 aa
MKLDVICMGNLNYDITFLMEKFPEFHEKVNAKSVYTGLGGSAGNTASWLASLRLRVGFIG
AVGNDDFGRLHIEYFKKVGVDTGGIKIVDDATGVAVMMVKGEDKRIVKYPGANRFKEVKE
EYLARARHLHLSSNPIELIREAIEKAKRLGLTVSFDPGEMEVPQDIEEKLDILMMNEDEF
KRKYGNLEKIKDVKARIAIATLNGGGALVRDESGEVHEIRGLSAKVVDTTGGGDSFNAGF
IYGFLNGWDVVSSAKLGMLLAYLTVQEVGARTAIRPLDEIRKIARGLKLEIPL
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaagctcgatgtaatctgtatgggcaacctcaattacgacataacgtttctaatggag
aagttcccagagttccatgagaaggttaatgcaaaatcagtgtatacagggcttggaggt
tccgcagggaatacggcaagctggctggcaagcttaagacttagagtgggattcatcggg
gctgttggcaatgatgactttgggaggttacacatagagtacttcaagaaagtaggtgta
gatactgggggaattaagatcgttgatgacgcaactggagttgcggtaatgatggtaaag
ggagaggataagagaatagtcaagtatcctggggcaaacagattcaaagaagtgaaggag
gaatacttggcgagagcaagacaccttcacctctcctctaaccctatagagctcataagg
gaggcaattgagaaggctaaaaggttgggattaacagtttcatttgatcccggagaaatg
gaagttccccaggatatcgaggagaagcttgacatcttgatgatgaacgaggacgaattc
aagagaaagtatggcaacttagaaaagataaaggatgtgaaggctaggatagctatagca
accttgaatggtggtggagctctcgttagggatgagagtggagaggtacatgaaataagg
ggattatcggctaaggtcgttgatacaaccggaggtggagattcattcaatgcgggcttc
atatacggctttctcaacggatgggacgttgtaagctcggctaagctcgggatgctctta
gcttatttaacggttcaagaggtaggggcaagaacagccattagaccccttgatgaaata
agaaaaattgccagagggctcaagctcgaaatccccctttaa

DBGET integrated database retrieval system