KEGG   Thermococcus camini: TIRI35C_1976
Entry
TIRI35C_1976      CDS       T07551                                 

Name
(GenBank) Sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tcq  Thermococcus camini
Brite
KEGG Orthology (KO) [BR:tcq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TIRI35C_1976
Enzymes [BR:tcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TIRI35C_1976
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: CAD5245130
UniProt: A0A7G2DAV6
Position
TIRI35C:complement(1812043..1812966)
AA seq 307 aa
MPRSFHRRGERMAEFDVVGIGNLNYDIIMLIERFPEFHEKVNAEEAFFGLGGAAANTISW
LAHFGLRTGYIGAVGRDEIGQAHLSYFRRIGVDTGGIRVVDVPSGVAIAMIRGEDKRIVK
YPGANLFKDIDFDYLSRARHVHLSSNPPETIVDVVNFANSRGITVSLDIGEAELPPEVER
KVDYLMMNEDEYRRKFGSLDLSLSGAKNLVVTLNGGGALVRDASGNVHEIRGLSAEVVDS
TGAGDSFDAGVVYGVLNGWGLDDAARLGMLLAYLTVQKVGARSAVMSLEDVIAAAGKVGL
NLPFGRN
NT seq 924 nt   +upstreamnt  +downstreamnt
atgccccgtagcttccaccgcaggggtgagaggatggcggagttcgatgtggtggggatt
ggaaacctcaactatgacatcataatgctcatcgagcgttttccggaatttcacgagaag
gtcaacgcggaggaggctttctttggcctcggtggagcggccgcgaacaccataagctgg
ctcgcgcacttcggtctgagaaccgggtacataggcgccgtcgggagagacgagataggc
caggcccacctctcgtactttagaaggataggcgttgatacgggaggaataagggtcgtc
gatgtcccatcgggtgtggccatagcgatgatacgtggggaggacaagagaatagtgaag
taccccggtgcgaaccttttcaaggacatcgatttcgactatctctccagggcgaggcac
gttcacctctcctccaatccgccggagacgatagtggatgttgtcaattttgccaactcg
cggggcatcacggtctccctcgacataggcgaggcggagcttcctccagaggttgagaga
aaggtggattacctgatgatgaacgaggatgagtaccggagaaagttcggttccctcgac
ctctccctctcgggggccaaaaatctcgtggttaccctgaacgggggaggggcgctggtc
agggacgcctccggaaacgttcatgaaatcagggggctcagcgcggaggtcgttgattcc
accggtgccggggactcatttgacgcgggcgttgtatatggtgttctcaacggatggggg
ctggacgacgccgcgaggctcgggatgcttctggcgtacctcaccgttcagaaggttgga
gccagaagcgcggtgatgtcccttgaggacgtcatagctgctgcagggaaggttggtctc
aacctgcccttcggcaggaactga

DBGET integrated database retrieval system