KEGG   Trypanosoma cruzi: 509499.14
Entry
509499.14         CDS       T01012                                 

Name
(RefSeq) tryparedoxin peroxidase
  KO
K11186  mitochondrial tryparedoxin peroxidase, trypanosomatid typical 2-Cys peroxiredoxin [EC:1.11.1.-]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00480  Glutathione metabolism
tcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    509499.14
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     509499.14
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC OKR_DC_1_C
Other DBs
NCBI-GeneID: 3536832
NCBI-ProteinID: XP_806739
GeneDB: Tc00.1047053509499.14
UniProt: Q4CX87
AA seq 226 aa
MFRRMAVTSLQKGLSRRAFCNTPRLLNLDYQAYKTATVREAAPEWAGKAVVNGKIQDISL
NDYKGKYVVLLFYPMDFTFVCPTEITAFSDAQAEFDKINTQVVAVSCDSQYSHLAWINTP
RNKGGLGEMSIPVLSDLTKEIARDYGVLIEEQGISLRGLFIIDDKGILRHITVNDLPVGR
NVEEVLRVVQAFQYVDKNGDVIPCNWRPGKPTMKTEKANEYFEKNA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtttcgtcgtatggccgtgacttcgttgcagaagggtctttcacgccgagctttctgc
aacaccccgcgacttcttaacctggactaccaagcatataagactgccacggtgcgcgag
gcagcacctgagtgggcaggaaaggctgtcgtgaatggaaaaatccaggacatcagcttg
aatgactacaagggcaagtatgttgttcttcttttttatcctatggattttacctttgtg
tgccccacggaaatcacagccttttcagatgctcaggctgaatttgataagattaacacc
caggtcgtggctgtatcgtgcgacagccaatattcacaccttgcttggataaacactcca
agaaataaaggtggccttggggaaatgagtattcctgtgctttctgatctcaccaaggaa
attgcccgcgactatggagttttgatcgaggagcaagggatctctctgcgcggactgttc
atcattgacgataaagggattctgcgccacatcacggtgaatgacttaccagtgggcaga
aatgttgaagaggtgcttcgggttgtgcaggcgtttcagtatgtggacaaaaacggagat
gtaattccatgtaactggaggccaggcaaaccgacaatgaaaactgagaaggcaaatgaa
tattttgagaaaaacgcataa

DBGET integrated database retrieval system