KEGG   Triticum dicoccoides (wild emmer wheat): 119352891
Entry
119352891         CDS       T07278                                 

Name
(RefSeq) cytochrome P450 93G1-like
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
tdc  Triticum dicoccoides (wild emmer wheat)
Pathway
tdc00941  Flavonoid biosynthesis
tdc01100  Metabolic pathways
tdc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    119352891
   00943 Isoflavonoid biosynthesis
    119352891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tdc00199]
    119352891
Enzymes [BR:tdc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     119352891
Cytochrome P450 [BR:tdc00199]
 Cytochrome P450, plant type
  CYP93 family
   119352891
SSDB
Motif
Pfam: p450 RepB
Other DBs
NCBI-GeneID: 119352891
NCBI-ProteinID: XP_037475380
Position
2A:complement(21575799..21577831)
AA seq 546 aa
MATASSMQQPALLLRQLTQDPVTASLLAAALATAVLMIAAVSRGGGRKPRLPPSPRGFPV
IGHLHLVRPPVHRTFHDLAARLGPLMHIRLGSTHCVVASSAGVAAELIRAHEGKISERPL
TAVARQFAYGDDGFAFAPYGPHWRSMKRLCMSELLGPRTVEQLRPVRRAGLVSLLQSVLH
RASGAEAVDLTAALIRLSNTSIIRMMASTVPGSVTEEAQALVKAVAELVGAFNVEDYIAV
CRGWDLQGLRRRAADVHRRFDALLEEMIRHKEEAREARKMRGGAEGETPEKKTATGTTTE
SSKDLLDILLDKLEDDAAAEVKLTRKKIKAFVIDVVTAGSDTSAAMVEWMLAELMNHPEC
LRKVRTEIDAVVGRDRIAGEGDVASLPYLQAAYKETLRLRPAAPIAHRQSAEEMVISAAG
GFTVPAGTAVFINLWSIARDPANWDAPLEFRPERFMAGGRNEALDPRGQHFQYLPFGSGR
RGCPGMGLALQSVPAVVAALVQCFDWAVDGDAEKIDMEEADGLVCARKHPLLLRPSPRLS
PFPAVV
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcaacggcgtcgagcatgcagcagccggcgctgcttcttcggcagctgacgcaggac
ccagtgacggcctccctcctcgcggccgcgctcgccaccgcggtccttatgatcgccgcc
gtgagcagaggcgggggacggaagccgcggctgccgccgagcccgaggggcttcccggtg
atcgggcacctgcacctggtgcgcccgccggtgcaccgcaccttccacgacctggcggcc
aggctgggcccgctgatgcacatccggctcggctccacccactgcgtcgtggccagctcg
gccggcgtcgccgccgagctcattcgggcccacgagggcaagatctcggagcggccgctc
acggccgtggcccgtcagttcgcctacggcgacgacggcttcgccttcgcgccctacggc
ccgcactggcgctccatgaagcgcctctgcatgtccgagctcctcggcccccgcaccgtc
gagcagctccgccccgtccgccgcgccggcctcgtgtccctgctgcagagcgtgctgcac
cgggcgtcgggtgctgaggcggtcgacctcaccgccgcgctcatccggctgtccaacacg
tccatcatcaggatgatggccagcaccgtgcctgggagcgtcacggaggaggcgcaggcg
ctggtgaaggccgtggcggagctagtcggcgcgtttaacgtcgaggactacatcgccgtg
tgccgcggctgggacctccagggcctccgccgccgggccgccgacgtccaccgccgcttc
gacgcgctgctcgaggagatgattcggcacaaggaggaggcccgagaggccaggaagatg
cgtggcggagcagaaggagagacgccggagaagaagacggccacgggaacgacgacggag
agcagcaaggacttgctcgacatcctgctggacaagttggaggacgacgcggcggcggag
gtgaagctcaccaggaagaagatcaaagccttcgtcatcgacgtggtgaccgcgggctcc
gacacgtcggcggcgatggtggagtggatgctggcggagctgatgaaccacccggagtgc
ctccgcaaggtgcgcacggagatcgacgcggtggtggggcgcgacaggatcgcgggcgag
ggcgacgtggcgagccttccctacctgcaggcggcgtacaaggagacgctccggctgcgc
ccagcagccccgatcgcgcaccggcagtcggcggaggagatggtgatctccgcggccggc
gggttcacggtgccggcgggcacggcggtgttcatcaacctgtggtccatcgcgcgcgac
ccggccaactgggacgcgccgctggagttccggccggagcggttcatggccggcggccgc
aacgaggcgctggacccgcgcgggcagcacttccagtacctgccgttcgggagtggccgg
cgcgggtgccccggcatggggctcgcgctccagtccgtgcccgccgtcgtggcagccctc
gtgcagtgcttcgactgggccgtggacggcgacgcggagaagatagacatggaggaggcc
gacgggctggtgtgcgcgcgcaagcacccgctgctgctccggccctcgccacgcctcagc
cccttcccggcggtcgtctaa

DBGET integrated database retrieval system