KEGG   Triticum dicoccoides (wild emmer wheat): 119361919
Entry
119361919         CDS       T07278                                 

Name
(RefSeq) cytochrome P450 93G1-like
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
tdc  Triticum dicoccoides (wild emmer wheat)
Pathway
tdc00941  Flavonoid biosynthesis
tdc01100  Metabolic pathways
tdc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    119361919
   00943 Isoflavonoid biosynthesis
    119361919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tdc00199]
    119361919
Enzymes [BR:tdc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     119361919
Cytochrome P450 [BR:tdc00199]
 Cytochrome P450, plant type
  CYP93 family
   119361919
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 119361919
NCBI-ProteinID: XP_037482989
Position
2B:complement(27504354..27506397)
AA seq 549 aa
MAMASSMEQPALLLLRQLTQDPVTASLLAAALATAVLMIAAVSRGGGRKPRLPPSPRGFP
VIGHLHLVRPPVHRTFHDLAARLGPLMHIRLGSTHCVVASSAGVAAEFIRTHEGKISERP
LTAVARQFAYGDDGFAFAPYGPHWRSMKRLCMSELLGPRTVEQLRPVRRAGLVSLLQSVL
HQASGAEAVDLTAALIRLSNTSIIRMMASTVPGSVTEEAQALVKAVAELVGAFNVEDYIA
VCRGWDLQGLGRRAADVHRRFDALLEEMIRHKEEAREARRMRGGGEGETPEKKTATGTTT
ESSKDLLDILLDKLEDDAAAEVKLTRKKIKAFVIDVVTAGSDTSAAMVEWMLAELMNHPE
CLRKVRSEIDAVVGRDRIAGEGDVASLPYLQAAYKETLRLRPAAPIAHRQSTEEMVVTAA
GGFTVPAGTAVFINLWSIARDPANWDAPLEFRPERFLAGGRNEALDPRGQHFQYLPFGSG
RRGCPGMGLALQSVPAVVAALVQCFDWAVPADIDGKKIDMEEADGLVCARKHPLLLRPSP
RLSPFPAVV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcaatggcgtccagcatggagcagccggcgctgcttcttcttcggcagctgacgcag
gacccagtgacagcctccctcctcgcggccgcgctcgccaccgcggtccttatgatcgcc
gccgtgagcagaggcgggggacggaagccgcggctgccgccgagcccgcggggtttcccg
gtgatcgggcacctgcacctggtgcgcccgccggtgcaccgcaccttccacgacctggcg
gccaggctgggcccgcttatgcacatccggctcggctccacccactgcgtggtggccagc
tcggccggcgtcgccgccgagttcatccggacccacgagggcaagatctcggagcggccg
ctcacggccgtggcgcgccagttcgcgtacggcgacgacggcttcgccttcgcgccctac
ggcccgcactggcgctccatgaagcgcctctgcatgtccgagctcctcggcccccgcacc
gtcgagcagctccgccccgtccgccgcgccggcctcgtgtccctgctgcagagcgtgctg
caccaggcgtcgggtgctgaggcggtggacctcaccgccgcgctcatccggctgtcgaac
acgtccatcatcaggatgatggccagcaccgtgcccgggagcgtcacggaggaggcgcag
gcgctggtgaaggcggtcgcggagctcgtcggcgcgttcaacgtcgaggattacatcgcc
gtgtgccgcggctgggacctccagggcctcggtcgccgggccgccgacgtccaccgccgc
ttcgacgcgctgctcgaggagatgatacggcacaaggaggaggcccgagaggccaggagg
atgcgtggtggaggagaaggagagacgccggagaagaagacggccacgggaacgacgacg
gagagcagcaaggacttgctcgacatcctgctggacaagttggaggacgacgcggcggcg
gaggtgaagctcaccaggaagaagatcaaagccttcgtcatcgacgtggtgaccgctggc
tccgacacgtcggcggcgatggtggagtggatgctggcggagctgatgaaccacccggag
tgcctccgcaaggtgcggtcggagatcgacgcggtggtggggcgcgacaggatcgccggc
gagggcgacgtggcgagcctcccgtacctgcaggcggcgtacaaggagacgctgcggctg
cgcccggcggccccgatcgcgcaccggcagtcgacggaggagatggtggtgaccgcggcc
ggcgggttcacggtgccggcgggcacggcggtgttcatcaacctgtggtccatcgcgcgc
gacccggccaactgggacgcgccgctggagttccggccggagcggttcctggccggcggg
cgcaacgaggcgctggacccgcgcgggcagcacttccagtacctgccgttcgggagcggc
cggcgcgggtgccccggcatggggctggcgctccagtccgtgcccgccgtcgtggcggcc
ctggtgcagtgcttcgactgggccgtgcccgccgacatcgacgggaagaagatagacatg
gaggaggccgacgggctggtgtgcgcgcgcaagcacccgctgctgctccgcccctcgccg
cgcctcagccccttcccggcggtcgtctaa

DBGET integrated database retrieval system