KEGG   Torulaspora delbrueckii: TDEL_0E01900
Entry
TDEL_0E01900      CDS       T02236                                 

Symbol
TDEL0E01900
Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl03440  Homologous recombination
tdl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    TDEL_0E01900 (TDEL0E01900)
   03450 Non-homologous end-joining
    TDEL_0E01900 (TDEL0E01900)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tdl03400]
    TDEL_0E01900 (TDEL0E01900)
DNA repair and recombination proteins [BR:tdl03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     TDEL_0E01900 (TDEL0E01900)
   NHEJ (non-homologous end-joining)
    MRX complex
     TDEL_0E01900 (TDEL0E01900)
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-GeneID: 11503834
NCBI-ProteinID: XP_003681644
UniProt: G8ZUY9
Position
5:359266..361554
AA seq 762 aa
MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK
LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS
QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT
NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQEALE
RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKLHTLVDLVNAVSHNT
VKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVKRRR
YNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTAKTSITTQINVPENDASQESS
AFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQA
NLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQV
DTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAK
YKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESSKEMQDFPEASEQTSRQFSVP
QVIDDPEDAEPFTFTRHTSGTPANNGLFVVDEDDSQNDVVLAARESIRPEEAVQLVDPSP
RRSRSLPYSPGKRKRENRRSPYDDDDDEDDDEPKFKFSRRLK
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgtggatactgaagtatacgtatgaactagaagatggaaccattcgtcgtgtatcatcg
tgcctcgttaaacaacagactttcagcattggtcgttccagtaagaaccctctcaatatc
aagaatgacaaaagtatctcgaggaatcatataagtgtggtttgggattcagaggtcaag
ctcataagacttattaaccagggaagactgacagcggctggtggaaagtaccttaaagtt
ggcgagtctatggatttcgaggagaagcttcacatacgtgagcccataataatagagctt
ggcacgaaacctataaaggtcgaagtagtttggcaagatgtagtatttgatctgcctagc
cagctttcacaattcatagacactttggaccatgtcggtattggagtgaaagctgataca
gtggataatcgctctacaacgattattgtgactgataaaataaagtttgcttacaagtgc
ctcttcggcctcatcaatggcgcagttataagaaactcacagttcttggttgaagttacc
aacatactttccaaacccaccacgacatttgaagaatcatgggatagtttaattcaaaac
gaatcttacatgctatatccgaacaatttaggcccacacgaagttatactcaagggatat
aagttttatttgatagcgtctgacgttataaccatggcctatgttcaagaagcgctcgag
cgcggcaatggtgagttgattgttgtcgaaaatactgagcagttactggataggctaaag
caagagaattcaactgacgatttgatagttttgaaagctgaagaaactacaaagatccca
ggtgacaaaatcaagcttcatacattagtggatcttgtcaatgctgtttcccataacaca
gtgaaaactctactagggggagttccaccgatggaggcaggtcctggcgatgtgattggc
agtcatcaacccacactcacaaagaccgaggtaagttcaagccaaagtttgagtaacaaa
gagcacacgcctgaacatacagtaacgcctgccgagaagccaccagtcaaaagaagacgt
tacaacagggtcaaaccgcttgacagtctaatgttctttgcaggtggagactattccaca
gaggaaccagagcaggaaatatcaactcagcctgtaaacccagcggcaagcgatactgcc
aagacaagtataacgactcagattaacgttcccgagaacgatgcctcccaggaaagttct
gcatttgacaaatttcagcctaatatagtcctcaaaaattctgccaaacctctgacgatt
gattctcctggcgatgcacacaatactcatgagataaacactgcgaatcagcatgtgaaa
gatattgcccaacagatagagatgaatcatccagaatctgagcagcaaagtgaacaagca
aacctcaatatggtagaaaccactccaagacccactgcacggaaaaagacattacaagac
ttcaaaagtactgtcaataatccagataactctgcttcctctactgagggtttagtagat
ttgataaaagatgcaaaaagccgcgaagtgaaacggcttaaatcaacattggtgcaggta
gatactgacgagttgactgaagatgcgataaatcaattgggagacctcgccattgttcaa
ccaaatgactccctaatacggcgtcaaaagattgacagtgcagaaacttctcgtaacgat
cagcacccaccatgggatggtcggaagaatttcaagaatttcgtcaaagttcaggctaaa
tacaaagaacagcgaatgggtgaaaactaccgggaaggctcttcagactttatccgcaat
agtgggtacctcttaaccaggcagtacgttccttccaagatatataccaaggaatcatct
aaagaaatgcaggattttcccgaagcttcggagcagacctcaaggcaatttagtgttcct
caagtcatcgatgatcctgaagatgcggaaccattcacttttactcgtcatacgagcggt
actcccgccaacaatggactttttgttgttgatgaagatgattcccaaaatgatgtagtt
ttagcggccagggaatctatcagaccagaagaagccgttcaattggtcgatccatcaccc
agacgatcaaggtccttgccctattctccagggaaacgtaagcgtgaaaacaggcgcagc
ccttatgatgatgatgatgatgaagatgatgatgaacccaaattcaagtttagtagacgg
ctcaaataa

DBGET integrated database retrieval system