KEGG   Thermococcus eurythermalis: TEU_01625
Entry
TEU_01625         CDS       T03421                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
teu  Thermococcus eurythermalis
Brite
KEGG Orthology (KO) [BR:teu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TEU_01625
Enzymes [BR:teu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TEU_01625
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AIU69140
UniProt: A0A097QRN5
Position
294667..295539
AA seq 290 aa
MFDVIGMGNLNYDIIFLLDRFPEFHEKVVSKEAHFGLGGAAGNTISWLATFGLKTGFIGA
VGRDEIGEAHLRYFEKLGVDTSGIDVVDVPSGVAVAMVHGDDKRIIKHPGANALRKFKPD
YARKAKLLHLSSNPPELIEEAVRFANANGILISVDIGEATLPREVEGMIDHLLMNEDEYR
RKYGSLDTSLSNAKNLIITLNGGGALVREGDETYEVRGLSARVVDSTGAGDSFDAGVIYG
VLQGWSLRDAAKLGMLLAYLTVQKVGARSAIIPLEEVIKMSKELNLDLPW
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtttgacgtcatcgggatgggcaacctcaactacgacataattttcctccttgaccgc
ttccccgagttccatgagaaggtcgtctcaaaggaggcacacttcggcctcggaggtgcc
gccgggaacacgataagctggctcgcgacgttcggactgaagaccggattcatcggcgcc
gttggaagggacgagattggcgaggcccacctgaggtacttcgaaaagctaggcgttgac
acgtccggcatagacgttgttgacgtcccgtcaggagtggctgtggccatggttcacggg
gacgacaagaggattatcaagcaccccggcgccaacgcactcaggaagttcaagccggac
tacgcgagaaaggcgaagctcctgcacctctcgtccaacccgccggagctcatagaggaa
gccgtccgcttcgcgaacgccaacggaatcctgatttcggtggacatcggagaggcgact
ctgccgagagaagttgaggggatgatagaccacctcctgatgaacgaagacgagtacagg
aggaagtacggctccctcgacacttccctcagcaacgcaaagaacctcataataaccctc
aatgggggaggagcactcgtccgtgaaggggacgagacctacgaagtccgcggactgagc
gcaagggtcgttgacagcacgggggcgggagactccttcgacgcgggagtgatttacggg
gttctccagggatggtctctcagagacgccgccaagctcggcatgctcctggcctatctg
accgtccagaaggtcggcgcgaggagtgcaataataccgctcgaagaggtcatcaaaatg
tcaaaagagctgaacctcgatttgccatggtaa

DBGET integrated database retrieval system