KEGG   Thermococcus gammatolerans: TGAM_0139
Entry
TGAM_0139         CDS       T00920                                 

Symbol
rbsK
Name
(GenBank) Sugar kinase, putative ribokinase (rbsK)
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tga  Thermococcus gammatolerans
Brite
KEGG Orthology (KO) [BR:tga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TGAM_0139 (rbsK)
Enzymes [BR:tga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TGAM_0139 (rbsK)
SSDB
Motif
Pfam: PfkB Methyltransf_31
Other DBs
NCBI-ProteinID: ACS32641
UniProt: C5A329
Position
complement(136326..137213)
AA seq 295 aa
MFDVIGIGNLNYDIIMLVDRFPEFHEKISAKKAVFGLGGAAGNTITWLAHMGLKTGFIGA
VGNDEVGRAHIEYFKRIGVDTGGIKVVDVPSGIAVAIIHGEDKRIVKYLGANEKRELDFD
YMKRARHIHLSSNPPRIIREAIEFASENGITVSLDIGEAPLPEDVEERIDYLLMNEDEYR
RKFGSLDPSLSKAKNLIITLNGGGAIVRDQQGRIKEIRGLSAKVVDSTGAGDSFAAGIIF
GVLKGWSLEDSAKLGMLLAYLTVQKVGARSAVVPLERIVEKSRELNLNLPFDGNP
NT seq 888 nt   +upstreamnt  +downstreamnt
atgttcgacgtgattggaataggaaacctcaactacgacataataatgctagtggatcgc
tttccagaattccatgaaaagatttcggccaaaaaagccgtcttcgggctgggaggtgca
gcggggaacacgattacgtggcttgcccatatggggctgaaaactggcttcataggtgcc
gttggaaacgacgaggtcggacgggctcacattgagtacttcaaaagaattggagttgac
accggtggaataaaggtggtagatgtcccatcgggcatagccgtcgcgataattcacggg
gaggataaaaggatcgttaaatacctcggtgctaacgagaaacgggagctggacttcgac
tacatgaagagggcaagacacatccacctttcgtccaatccacccagaataatcagagag
gccattgaattcgcaagtgagaacgggataacggtctccctagacattggagaagccccc
ctccccgaggacgtggaggagaggatagactacctcttgatgaacgaggacgagtacagg
cggaagtttggttcactagatccaagcctatcaaaggccaagaacctcataataacgctg
aacggcggcggggcaattgtcagggaccaacagggcaggataaaggagatccgggggctc
agcgcgaaggtcgtggactcaacgggtgccggcgattccttcgctgcgggaatcatcttc
ggagtgctgaagggctggtctctggaggattccgcaaagctgggcatgttgctggcctat
ctgaccgtccaaaaggtcggggccaggagtgcggttgtgccgctcgaaaggatagtggag
aagagcagggagctcaatctgaaccttccgttcgatgggaacccttaa

DBGET integrated database retrieval system