KEGG   Torulaspora globosa: HG536_0E01010
Entry
HG536_0E01010     CDS       T06981                                 

Name
(RefSeq) uncharacterized protein
  KO
K10868  DNA repair protein XRS2
Organism
tgb  Torulaspora globosa
Pathway
tgb03440  Homologous recombination
tgb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tgb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HG536_0E01010
   03450 Non-homologous end-joining
    HG536_0E01010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tgb03400]
    HG536_0E01010
DNA repair and recombination proteins [BR:tgb03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     HG536_0E01010
   NHEJ (non-homologous end-joining)
    MRX complex
     HG536_0E01010
Motif
Pfam: FHA BRCT_2 FHA_2 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 59326386
NCBI-ProteinID: XP_037139864
Position
5:complement(186416..188743)
AA seq 775 aa
MWILRYKYDLDDGTIRNVSRCLQSGQTYTIGRSSKSLLNIKNDKSISRNHVSLSWNKENG
RITLSNQGKLTAAGGKYLKVGEDMIFQESLFRDKNVVIELGTKPITVDISWKDAIWDIPQ
SFSGFTEELGQFGIEAQVGKADVRSTAVVVAENEAHRSLFGLVHNIPLKTAQFLCSAKDV
LSSSDATFDESWSKLDRNERTMVVPSGRTLEQVFSGLKFYMIERNEQVTKYTQKAITRGG
GELVCVGALKELLGLLKLEDSTQNLVVIQSPESAVQVAQAGIIAFTLDDIVSKVQDNATA
KLLGGVPNFSLAAPILEGSPEVSSGDKLGLASQARQTSEEPNQDVEKRPRKKRRLNRRAV
KPLDSLMFFAGGDSFKSEALSDTSMPSLEKKAPSPKDNLAHAGPTASLGAASALETKEQP
TFANESYENQVHHSALREPTQPISPSVNTPVPVENFDERTRDREIDEVKISQEQNYPIYD
DGVVMKKQPTRQRTLRDTSLSENDSRRAATPKEDLVEVINDTKNREVKRLNSTLIQVSTD
ELTEDAINQLGNLAIIRPNENLMREREHDNSEQTAEHNTPWHGRKNFKNFFKIQPKYKKD
HFSDKYREGSSDFIRRSAFSLIKEYVPLKPYSRELPKRVEDFPPIAKERSVSGTALDRAR
DHSPEQASSTHYSNGSTPVQELFVVDEDDSQSAHLTVPGEQTLQAEESETADVLPSRQTS
GLMQTRKRKTTTRRSPARFSNIENEDSGDDDDDDDDDDDDADEPKFKFRRRMRYS
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgtggatactgaggtacaagtatgatttagatgatggtactatccgcaacgtatcacgc
tgtctccagagcgggcaaacctataccattggtcgctccagtaagagtttgctcaatata
aagaatgataaaagcatatcgagaaatcacgtcagcctgagttggaataaggagaatggg
cgaatcacccttagcaaccagggcaaattgacagcagctggtggcaaatatctcaaagtt
ggtgaggacatgatctttcaagaatctttgttcagagacaaaaacgtcgtaatcgagctt
ggaaccaagccgataacggtagatatttcgtggaaggatgctatatgggacattccgcag
agcttttctggttttacggaggagcttggccaattcggaatcgaagcgcaggttggaaag
gcagatgtacgatcaactgcggtagtggtggccgaaaatgaagcccaccggtctcttttt
ggtcttgtccataatataccgctcaagacggcgcagtttttatgcagtgcgaaagatgta
ttgtcatcttcagacgctactttcgatgaatcctggagtaaattggaccgcaatgaacgg
acgatggtagtgccaagtggccgcactctggagcaagtcttcagtggtctgaagttctat
atgattgaacggaatgaacaagtaactaagtatacccagaaggctattaccagaggaggc
ggcgaactagtgtgcgttggagccttgaaagagttgctaggtttgttgaagttagaggac
tccactcaaaatttggtagtgatacagtcgcctgaatctgcagtacaggtggcccaagcg
ggtattattgctttcacccttgatgatattgtctcgaaagttcaagataacgccacagcg
aaactgctgggtggagtaccgaatttctcgttagcagcaccaattttggaaggctcacct
gaggtaagctcgggcgataaactgggactagcatcgcaagctcgccagacatctgaggaa
ccaaatcaagatgtcgaaaaacggccaagaaagaagaggcgactcaacagacgagcagtt
aagccccttgacagtctgatgttttttgcaggaggtgattcattcaagtccgaggccttg
tctgatacttcaatgccctctctagagaagaaagcgccgtcgccgaaggataaccttgcg
cacgctggaccaacagcgagcttaggagccgcttctgcgctggaaactaaagaacagcca
acatttgctaatgaatcatacgagaatcaggttcatcattcagctttgcgcgaaccgacg
caaccgattagtcctagcgttaatactcctgttccagtagaaaactttgatgaaagaact
agggacagagagatcgacgaagtcaagatttcacaagagcaaaattatccaatttacgat
gatggagttgttatgaagaagcagcctacacggcagaggacgctgcgggatacaagttta
agcgagaatgattcgcgcagagcagctacgccaaaagaagacttggtggaagtcatcaac
gataccaaaaatcgcgaagtaaagcgattaaattcaactttgattcaagtctcgacagat
gaactgactgaggatgctatcaaccaactaggaaatttggctattatccgacccaatgaa
aatttaatgagggaaagggagcacgataacagcgagcagactgcagagcataatacgccg
tggcatggccgtaaaaactttaagaatttcttcaaaattcaaccaaaatataagaaagac
catttcagtgataagtaccgggaaggatcatcagatttcatacgcagaagtgcattttcg
ctaatcaaagaatatgtaccgctgaagccatattccagagaactgccgaaaagggtcgaa
gatttccctccaattgcaaaagaaagatctgtttctgggactgctcttgaccgagctcga
gatcattcacctgaacaggcaagttccacgcattattcgaatggatcaactccggttcag
gagctctttgtggtggatgaagatgattcacagagtgcgcacctcacagtgccaggggag
cagaccctacaagctgaagaatctgaaacagcagatgtgctcccgtcgcggcaaacttct
gggttgatgcaaacaagaaagcggaaaacaaccaccaggcgaagccctgctcgctttagt
aatatagaaaacgaggacagcggagatgatgatgatgacgatgatgatgacgatgacgac
gctgatgagccaaagttcaagtttaggagacgaatgagatattcgtaa

DBGET integrated database retrieval system