KEGG   Thermococcus guaymasensis: X802_04655
Entry
X802_04655        CDS       T04184                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tgy  Thermococcus guaymasensis
Brite
KEGG Orthology (KO) [BR:tgy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    X802_04655
Enzymes [BR:tgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     X802_04655
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AJC71538
UniProt: A0A0X1KJV2
Position
complement(821379..822266)
AA seq 295 aa
MLDVIGIGNLNYDIIMLVDRFPEFHEKISAKKAVFGLGGAAGNTITWLAHMGLKTGFIGA
VGNDEVGRAHIEYFKKIGVDTGGIKVVDVPSGIAVVIIHGEDKRIVKYLGANEKRELDFD
YMKQARHIHLSSNPERIIKEAVEFASENGIGVSVDIGEAPLPAGIEEKIDYLLMNEDEYR
RKFGSLDPSLSTAKNLIITLNGGGALVRDSKGRVREVRGLSAEVVDSTGAGDSFAAGVIF
GVLNGWSLEDSAKLGMLLAYLTVQKVGARSAVVPLERIVEKSRELNLNLPFDGNP
NT seq 888 nt   +upstreamnt  +downstreamnt
atgctcgatgtcattgggatcggaaacctcaattatgatataataatgctggtggacagg
ttcccggagttccatgaaaagatatcggcaaagaaagcggtctttgggctgggaggtgca
gcagggaacacaatcacatggctggctcacatggggctaaaaactggcttcataggggcg
gttgggaacgacgaggttggacgggctcacatagaatacttcaagaaaattggggttgac
acaggaggaataaaggtagtagatgtcccctccggaatcgcggtggtgataatccacggg
gaagacaaaaggatcgttaagtacctcggcgcaaacgaaaagagggaactggactttgat
tacatgaaacaggcacggcacatccacctttcctcaaacccggagagaataataaaggaa
gccgttgagtttgcaagcgagaacggaataggagtttcagttgacataggtgaagccccc
ctcccagcgggtatcgaggagaaaatagactacctgctgatgaatgaagacgaatacagg
agaaagttcggatctttggatccaagcctctcaacggcgaaaaaccttataataaccctc
aacggaggaggtgcgctagtcagggacagcaaaggccgtgtcagagaggtcagaggattg
agcgcagaggtagttgattctactggcgccggagattcctttgcggcaggcgttattttt
ggagttcttaacggctggtctctggaggattcggcaaagctgggcatgttactggcctac
ctgacggtacagaaggtaggggctaggagcgcagttgtgccgctcgagaggatagtggag
aagagcagggagcttaatctgaaccttccgttcgatgggaacccttaa

DBGET integrated database retrieval system