KEGG   Thalassospira sp. A40-3: IT893_15705
Entry
IT893_15705       CDS       T08364                                 
Name
(GenBank) N-acetyl sugar amidotransferase
Organism
thai  Thalassospira sp. A40-3
SSDB
Motif
Pfam: NAD_synthase QueC Asn_synthase tRNA_Me_trans ThiI ATP_bind_3 PAPS_reduct Fe-ADH_2 FlgT_M
Other DBs
NCBI-ProteinID: QPO11187
Position
complement(3422212..3423333)
AA seq 373 aa
MNDRTLDSQICSKCVMDTSDPEISFDQFGVCNHCKQAELSLAQVKLTPDETRQKIGQLVD
RIRSYSADRKYDAVVGMSGGVDSSYVALLAHKLGLRVLAVHFDNGWNSEVAVKNIKTLVD
AFGFDLETYVINWPEFRDLQRSFIRAGVVDIEMLSDHAIMASMFDLAKRHNVRYVLSGTN
IATEHGMPRTWVWNKNDLTNIEDIHRKFGEIKLTSFPRMGLLKSTIRRKFHMGFEFVEIL
NLVNFRKDAAMKVLSEETGWTYYGGKHYESIFTKFYQAYILPVKFNIDKRKVHLSALVRN
GELTRAQALLELEKPLYQEDELRRDQAYVLKKLNLSQGEFDTVMAADPVPHSCYRTDKNI
RIIIKDIAEKLGL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaatgatcgcactttagacagccaaatttgttcgaaatgtgtaatggacacctcagat
cccgaaatttcgtttgatcagtttggggtatgtaaccattgcaaacaggcagagttgagc
ctggcacaggttaaactaacaccagacgaaactcggcagaagatcggtcaactggtggat
agaattcgcagctactcagctgatcggaaatacgatgcagttgtaggtatgtctggcggg
gtagactcatcttacgttgcattgctcgctcataaacttggtttgagagtcttggcggtg
catttcgacaatggatggaattccgaagttgctgtgaagaatattaagaccctagtcgat
gctttcggatttgacctcgaaacctacgtaattaattggcctgaattcagggatttacaa
cggagttttatccgtgccggtgtcgtcgacatagagatgctctccgaccacgcaattatg
gcgtcaatgtttgatttagctaagcgtcataacgttcggtatgttctttcgggcaccaat
attgccacagaacacggtatgcctagaacttgggtgtggaacaagaatgaccttacgaat
attgaagacatccacagaaaatttggcgaaattaagctaacgtcatttcctcgtatgggt
ttattaaagagtacaattcggcgaaaattccacatggggttcgagtttgtcgaaattctt
aatctagttaattttcgcaaagatgctgctatgaaagttttgagtgaggaaactggatgg
acatattatggaggaaaacactacgaatcgatatttacgaaattctaccaagcgtacatt
ttaccggtcaaatttaatattgataaacgaaaagtccatctgtcagctttagttagaaat
ggtgagctcacacgagcgcaagcgctgttggagctcgaaaaacctttgtaccaagaagat
gaacttcgcagagatcaagcctacgtccttaaaaagcttaatctaagccagggagagttt
gatactgtcatggcggcagaccctgttccccacagttgctaccgcacggataagaatatt
cgcattataattaaggatatagcggaaaaattggggctatga

DBGET integrated database retrieval system