KEGG   Thermococcus sp. 4557: GQS_08055
Entry
GQS_08055         CDS       T01588                                 

Name
(GenBank) carbohydrate/pyrimidine kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
the  Thermococcus sp. 4557
Brite
KEGG Orthology (KO) [BR:the00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GQS_08055
Enzymes [BR:the01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     GQS_08055
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AEK73507
UniProt: G0HLW4
Position
1531251..1532174
AA seq 307 aa
MPRSFHRRGERMAEFDVVGIGNLNYDIIMLIERFPEFHEKINAEEAFFGLGGAAANTISW
LAHFGLRTGYVGAVGRDEIGEAHLSYFRRIGVDTGGIRVVDVPSGVAIAMIRGEDKRIVK
YPGANLLKEVDFDYLSRARHVHLSSNPMETIERVVEFANEGGITVSLDIGEAPLSREIEE
KVDYLMMNEDEYRRKFGSLDLSLSGAKNLVVTLNGGGALVRDASGNVHEIRGLSAEVVDS
TGAGDSFDAGVIYGVLNGWGLDDAARLGMLLAYLTVQKVGARSAVMSLAEVIAVAREVGL
SLPFGRD
NT seq 924 nt   +upstreamnt  +downstreamnt
atgccccgtagcttccaccgcaggggtgagaggatggcggagttcgatgtggtgggaatc
ggcaaccttaactacgacatcataatgctcatcgagcgttttccggaattccacgagaag
atcaacgcggaggaagctttcttcggcctcggcggcgccgccgcgaataccataagctgg
ctcgcgcacttcggcctgagaaccggttacgtaggcgccgtcgggagagacgagataggt
gaggcgcacctctcgtacttcaggaggataggcgttgatacgggcgggataagggtcgtc
gatgtcccatcgggtgtggccatagctatgatacgcggggaggacaagaggatagtgaag
taccccggtgcgaacctcctcaaggaggtcgattttgactacctctccagggcgcggcac
gttcacctctcgtcgaacccgatggagacgatagagagggtggtggagttcgcgaacgag
ggggggataaccgtttccctggacataggggaggccccgctgtcgagggaaatcgaggag
aaggtcgattacctgatgatgaacgaggacgagtaccggaggaagttcggttccctcgac
ctttccctttccggggccaaaaacctcgtggtcaccctgaacgggggaggggcgctggtc
agggacgcctccggaaacgttcacgaaatccgagggctcagcgcggaggtcgttgattcc
accggcgcgggtgactcgtttgacgcgggcgttatctacggagtcctcaacggatggggg
ctggacgacgccgcgaggctcgggatgctcctggcgtacctcaccgtccagaaggttggg
gccagaagcgcggtgatgtcccttgcagaggtcatagccgttgcccgcgaggtgggtctc
agcctgcccttcggcagggactga

DBGET integrated database retrieval system