KEGG   Thermococcus sp. 2319x1: ADU37_CDS14320
Entry
ADU37_CDS14320    CDS       T04245                                 

Name
(GenBank) Ribokinase, putative
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
thv  Thermococcus sp. 2319x1
Brite
KEGG Orthology (KO) [BR:thv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ADU37_CDS14320
Enzymes [BR:thv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     ADU37_CDS14320
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: ALV63131
UniProt: A0A0U3S9Q0
Position
1205868..1206818
AA seq 316 aa
MYTKGRLEEKNINRSSGEDFRGERVFEVIAIGNLNYDIILLVERFPEFHEKVIAKRAHFG
LGGAAGNTASWLAHMGVKVGFIGAVGNDEIGEAHISYFKKIGVDVGGIKVVNEHSGIAIS
LIKGEDKRIVKHLGANAYRDVDFEYLSKARHIHMSSNPKELIEKTVNFAFENGISISLDI
GEAEVPESVEDKITYLLMNEDEFKRKYGSLVKIHDVRAKNVIITLNGGGAMIRDDKGKVF
EIRGLSAKVVDSTGAGDAFDAGFIYGVLKGWELRDAAKLGTLLAYLTVQKVGARSAIIPL
EEIKKIAEELNLGLPF
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtatacaaaaggacgtttagaggagaaaaatataaatcggtcaagcggggaagatttt
aggggtgagagagtgtttgaggtaattgcaataggaaacctcaactacgatataatccta
cttgtggagagatttcccgagtttcatgagaaggtaatcgccaagagagcccacttcgga
ttgggaggtgctgcaggcaataccgcttcttggctggcccacatgggagttaaggttggg
tttattggagcagtcggtaacgatgagattggcgaggcccacataagctattttaagaaa
attggcgttgatgtgggggggattaaagtcgttaacgagcactcgggaatagctatttcc
ctgataaaaggagaggacaagaggatagtaaagcatctcggtgctaacgcatacagagac
gttgattttgagtacctttccaaagctaggcacatccacatgtcatcaaacccaaaagag
ctcattgaaaagactgttaactttgccttcgagaatggaatttccatttcactggacata
ggcgaagcagaggtgccagaatccgttgaggacaagataacctatctcctcatgaacgaa
gatgagttcaagcgaaagtatggaagcctggtgaagatccacgacgttagagctaaaaac
gtcatcataacattaaacggcggtggggcgatgattagagatgataaagggaaagttttt
gagattagggggctgagtgctaaagtagtagattccaccggggctggagatgcctttgat
gccggatttatctatggggttcttaaaggatgggagctgagggatgcggcaaaacttgga
actcttctggcatatctaacggtgcagaaagttggcgcgagaagcgcgatcataccgttg
gaggagatcaaaaaaatagcagaagagctgaacttgggccttcccttttag

DBGET integrated database retrieval system