KEGG   Thermococcus indicus: FH039_11860
Entry
FH039_11860       CDS       T07099                                 

Name
(GenBank) carbohydrate kinase family protein
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tic  Thermococcus indicus
Brite
KEGG Orthology (KO) [BR:tic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FH039_11860
Enzymes [BR:tic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     FH039_11860
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: QDA32149
UniProt: A0A4Y5SPF1
Position
complement(2189075..2189962)
AA seq 295 aa
MEFDVVGIGNLNYDIIMLIERFPEFHEKVNAEEAFFGLGGAAANTISWLAHFGLRTGYIG
AVGRDEIGEAHLSYFRRIGVDTGGIRVVDATSGVAIAMIRGEDKRIVKYPGANLLKDIDF
DYLSRARHVHLSSNPMDTIEKVVEFASERGITVSLDIGEAPLSREIEEKVDYLMMNEDEY
RRKFGSLDLSLSGAKNLVVTLNGGGALVRDASGNVHEIRGLSAEVVDSTGAGDSFDAGVI
YGVLIGWGLDDAARLGMLLAYLTVQQVGARSAVMPLEDVIAAAGEVGLNLPFGRN
NT seq 888 nt   +upstreamnt  +downstreamnt
gtggagttcgatgtggtggggattgggaaccttaactacgacatcataatgctcatcgag
cgttttccggaatttcacgagaaggtcaacgcggaggaggctttcttcggcctcggcggc
gccgctgcgaacaccataagctggctcgcgcacttcggtctgagaaccgggtacataggc
gccgttgggagggacgagataggtgaggcgcacctctcgtacttcagaaggataggcgtt
gatacgggcggaataagggtcgtcgatgccacatcgggtgtggccatagcgatgatacgg
ggggaggacaagaggatagtgaagtaccccggtgcgaacctcctcaaggacatcgatttc
gactacctctccagggcgcggcacgttcacctctcctcgaacccgatggatacaatagag
aaggtggtggagttcgcgagtgaacgggggataacagtttccctggacataggggaggcc
ccgctgtcgagggaaatcgaggagaaggttgattacctaatgatgaacgaggatgagtac
cggagaaagttcggttccctcgacctttctctctcgggggccaaaaacctcgtggttacc
ctgaacgggggaggggcgctggtcagggacgcctccggaaacgttcacgaaatcaggggg
ctcagcgcggaggtagttgattccaccggtgccggtgactcgtttgacgcgggcgttatc
tacggtgttctcatcggatggggcctggacgacgccgcgaggctcgggatgcttctggcg
tacctcaccgttcagcaggttggggccaggagcgcggtgatgccccttgaggacgtcata
gccgccgccggggaggtgggcctcaacctgcccttcggcaggaactga

DBGET integrated database retrieval system