KEGG   Thermococcus kodakarensis: TK2029
Entry
TK2029            CDS       T00226                                 

Name
(GenBank) carbohydrate/pyrimidine kinase, PfkB family
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tko  Thermococcus kodakarensis
Brite
KEGG Orthology (KO) [BR:tko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TK2029
Enzymes [BR:tko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TK2029
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: BAD86218
UniProt: Q5JDG9
Position
complement(1824026..1824910)
AA seq 294 aa
MKLDVIGIGNLNYDIIFTLERFPEFHEKINARGAHFGLGGAAANTISWLAHFGLKTGYIG
AVGNDDVGEMHIKYFQGIGVDTGGIDVVEEPSGVAVAMVAGDDKRIVKYPGANLRRRFKP
EYASRAKFLHLSSNPPELIEEAVNFASQRGIKVSLDIGEAPLPRELESKVDYLMMNEDEY
RRKYGSLDPSLCRAKNLVVTLNGGGALVREGDNVFEVRGLSAKVVDSTGAGDSFDAGVIY
GVLNGWSLLDSAKLGMLLAYLTVQKVGARSAIVPLEEVKRIAREVGLDLPFNRT
NT seq 885 nt   +upstreamnt  +downstreamnt
gtgaagctggacgtcatcggcatcggcaacctgaactacgacataatattcacgctggaa
cgctttccagagttccatgagaagatcaatgccagaggtgcccactttggactgggcggt
gcagcagccaacacgataagctggctcgcccacttcggccttaaaacgggctacataggg
gcggtgggaaacgacgacgttggagagatgcacatcaaatacttccagggcatcggggtt
gataccggcggaatagacgtcgttgaagagccctcgggcgtggcagttgcgatggttgca
ggggacgacaagagaatagtcaagtaccccggggcaaacctcaggaggaggttcaagccc
gaatacgcatcgagggccaagtttctccacctctcatccaacccgccggagcttatagag
gaagcagttaatttcgcgagccagaggggaataaaggtctccctggatataggtgaggcg
ccgctcccgcgggagcttgagagcaaggtggactacctgatgatgaacgaggacgagtac
aggcgcaagtacgggagccttgacccgagtctttgcagggccaagaacctcgtggtcacg
ctgaacggcggtggtgcgctcgtcagggagggggataacgtcttcgaggtcaggggtctg
agtgcgaaggtagttgattcgacgggcgctggagattccttcgatgcgggcgttatctac
ggcgtcctcaacggctggtccctcctcgactccgccaagcttggaatgctgctcgcgtac
ctgaccgtccagaaggttggggcgaggagcgccatagtcccgcttgaggaggtaaagagg
atagcaagggaagtcggcctggatctgcccttcaataggacttga

DBGET integrated database retrieval system