KEGG   Thermococcus litoralis: OCC_07421
Entry
OCC_07421         CDS       T02800                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tlt  Thermococcus litoralis
Brite
KEGG Orthology (KO) [BR:tlt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OCC_07421
Enzymes [BR:tlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     OCC_07421
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: EHR79301
UniProt: H3ZL51
Position
complement(1726709..1727587)
AA seq 292 aa
MFDVIAIGNLNYDITLLVERFPEFHEKVIAKRAHFGLGGAAGNTASWLAHMGVKVGFIGA
VGNDEIGEAHINYFKKIGVDVGGIKVVNEHSGIAISLIKGEDKRIVKHLGANAYRDVDFE
YLSKARHIHMSSNPKELIEKTANFAFENGISVSLDIGEAEVPKSVEDRITYLLMNEDEFK
RKYGSLEKIHDVKAKNVIITLNGGGAMVRDDKGKVFEIRGLSAEVVDSTGAGDAFDAGFI
YGILKGWELRDAAKLGTLLAYLTVQKVGARSAIIPLEEIKKIAEELNLGLPF
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtttgatgtaattgcaataggaaacctcaactatgatataaccctcctcgtggagaga
tttcccgagtttcacgagaaggtaattgccaagagagcccacttcggattgggaggtgct
gcaggcaacaccgcttcttggttagcccatatgggagttaaggtgggatttattggagca
gtcggtaacgatgagattggcgaggcacacataaactactttaagaagattggcgttgat
gtggggggcattaaagtcgttaacgagcactcgggaatagctatctccctgataaaagga
gaggacaagaggatagtaaagcacctcggtgctaacgcatacagagacgttgattttgag
tacctttccaaagctaggcacatccacatgtcatcaaacccaaaagagctcattgaaaag
actgctaactttgccttcgagaatggaatttccgtttcgttggatataggtgaggctgag
gtaccaaagtctgttgaggacagaataacctacctgctgatgaacgaagatgagttcaag
cgaaagtatggaagcctggagaaaatccatgatgttaaagctaaaaacgtcatcataaca
ttaaacggcggtggagcgatggttagagatgataaagggaaggtttttgagattagaggg
ctgagtgctgaagtagtagattccaccggagccggagatgcctttgatgctggatttatt
tatgggattcttaaaggatgggagctgagggatgcggcaaaacttggaactctactagca
tatctaacggtacagaaagttggtgccagaagcgcaattatcccactggaggagatcaaa
aaaatagcagaagagctgaacttaggacttcccttttag

DBGET integrated database retrieval system