KEGG   Thalassobius mediterraneus: KUV46_09890
Entry
KUV46_09890       CDS       T07443                                 
Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
tmd  Thalassobius mediterraneus
Pathway
tmd00623  Toluene degradation
tmd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    KUV46_09890
Enzymes [BR:tmd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     KUV46_09890
SSDB
Motif
Pfam: Aldedh OmdA
Other DBs
NCBI-ProteinID: QYI99662
Position
1968806..1970287
AA seq 493 aa
MAEAFTDLDQIFLAGKWRKGSGETLTNTNPYSGEAIFEMKAATPDDVDEACKSARKAQKE
WAALPPSARSAKMSAFADALEARREEVMGWITREIGGTQVKAALEVQLVLGVLREAAVLP
FMVEGRILPEDIPGKESRSYRQPVGVIALISPWNFPLQLTARTLAPALAVGNGVVLKPAS
DSIVTGGTIFAKLLEEAGFPEGLVSVLPGGGSDIGTALIEHEIPRLVSFTGSTPVGRGIA
ETVAKSAILKPLELELGGNGPIVVLDDADIEAAVDAAIWGKFMHAGQICMAINRIIVDDS
IFDEFTDKFVERAKALKVGDPSKPDTFVGPLVNEDQADGVMELIEKAKSEGADCRLGGDR
DGLLIPPHVFVDVDEDSCLCTNEIFGPVAPIVRAKDEADALRLANKTEYGLSSSVFTGDI
ERGVAFAKQVEAGMTHVNDQPVNDSPFSPFGGEKNSGIGRFNGRWAVDAFTTDHWITIQR
EPRQYPYSLDDLG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggccgaagccttcaccgatctcgatcagattttcctcgccggcaaatggcgcaagggt
tccggcgagacgctgaccaacaccaatccctattctggtgaagccatcttcgaaatgaag
gcggccacgccggatgacgttgatgaggcatgcaagtccgccaggaaagcgcagaaggaa
tgggcggccctgccgccgtccgcgcggtctgccaagatgtcagcgttcgctgacgcgctc
gaagcgcggcgcgaggaagtcatgggctggatcacgcgagagattggcggcacgcaggtt
aaagcggcgcttgaagtgcaactcgtccttggcgtcctgcgcgaagcggccgtcctgccc
ttcatggtggaaggccgtatcctgccagaggatattcccggcaaggagtcccgatcctat
cgccaacctgtcggcgtcatcgccctcatcagcccttggaatttcccattgcagcttacc
gcccgcacgctcgcgccggcactggcggtcggcaatggcgtcgtgctgaaacctgccagc
gattcaatcgtcactggcgggacgatctttgcgaagctgctggaagaagcgggcttccca
gaaggcctcgtcagcgtcctgcccggcggtggctctgatataggaacagcgctgatcgag
catgaaataccgcgtctcgtttcctttacgggctccaccccggtcggccggggcatcgcc
gaaacggtcgcgaaatcggccatcctgaaaccgctggagcttgagcttggcggcaatgga
ccgatcgtcgttctggatgacgcagatatcgaggcggctgtcgatgccgccatctggggc
aagttcatgcatgccggacagatctgcatggcgatcaatcgcatcatcgtcgatgacagt
atctttgatgagttcacggacaaattcgtggaacgcgccaaggcgttgaaggtcggcgac
ccatcgaagcctgacacttttgtcgggccgctcgtcaacgaagaccaggccgatggcgta
atggagctgatcgagaaggcaaaatcggaaggcgctgattgccgtctgggcggagaccgc
gatggtctcctcatcccaccgcacgtcttcgtcgacgtcgatgaggactcctgcctttgc
accaatgagatctttggccctgttgccccgattgtgcgggcaaaggatgaggcagatgcg
ctccgtctcgcaaacaagacggaatacggcctctcaagttcggtcttcactggtgacatt
gaacgcggcgtcgctttcgccaagcaggtcgaggcgggcatgacccatgtgaacgatcag
ccggtcaacgactctccgttcagtccgtttggcggcgagaagaattcgggcatcggccgc
ttcaatggccgctgggcagtcgacgcgttcaccaccgaccactggatcaccatccagcgg
gagcctcgccagtatccatactcacttgatgatcttggttag

DBGET integrated database retrieval system