KEGG   Thermococcus nautili: BD01_1953
Entry
BD01_1953         CDS       T03065                                 

Name
(GenBank) Sugar kinase, ribokinase family
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tnu  Thermococcus nautili
Brite
KEGG Orthology (KO) [BR:tnu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BD01_1953
Enzymes [BR:tnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     BD01_1953
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AHL23555
UniProt: W8P7K4
Position
complement(1710433..1711305)
AA seq 290 aa
MLDVIGMGNLNYDIIFLLDRFPEFHEKVVSREAHFGLGGAAGNTISWLATFGLKAGFIGA
VGRDEIGEAHLKYFERLGVDTSGIDVVDVPSGVAVAMVHGDDKRIVKHLGANSLRKFKPE
YAKKARFLHLSSNPPELIEEAVRFANASGIPISVDIGEATLPREVEGMVDYLLMNEDEYR
RKYGSLDTSLSNAKNLIITLNGGGAIVREGDETFEVRGLSAKVVDSTGAGDSFDAGVIYG
ILKGWSLRDSAKLGMLLAYLTVQKVGARSAIVPLDEVIKLSKELGLDLPW
NT seq 873 nt   +upstreamnt  +downstreamnt
atgctcgacgtaatcggcatggggaacctcaactacgacataatcttcctgctcgaccgc
tttcccgaattccacgagaaggtcgtctccagggaggctcacttcggcctcggcggtgcg
gccgggaacacgataagctggctcgcaacctttggactgaaggcaggcttcatcggggct
gttggaagggacgagataggagaagcccacctgaagtacttcgaaaggctcggcgtcgac
acctcgggaatagacgtcgttgacgttccatcaggagttgccgttgcgatggttcacggc
gacgacaagaggatagtcaagcaccttggagccaactcgctcaggaagttcaagcccgag
tacgcaaagaaagccagattcctgcacctctcctcaaatcccccagagctcatcgaggaa
gcagtccgcttcgccaacgccagcggaattcccatctcggtcgatatcggagaggccact
ctaccaagggaagtggagggcatggttgactacctcctcatgaacgaggacgagtacagg
aggaagtacggctcgctcgacacctccctcagcaacgccaagaacctgataataacgctc
aacgggggcggggcgatagttcgcgagggggatgaaacctttgaggttcgcgggctgagc
gcgaaggttgttgacagcactggggctggagactccttcgacgcgggcgtaatctacgga
atcctgaagggatggtcgctcagggattcggcaaagctcggcatgctcctggcgtatctc
accgtccagaaggtaggcgcgaggagtgcaatagttccgctcgatgaagtcatcaaactg
tcaaaggagctgggcctcgatttgccttggtaa

DBGET integrated database retrieval system