KEGG   Thermococcus onnurineus: TON_1488
Entry
TON_1488          CDS       T00789                                 

Name
(GenBank) carbohydrate/pyrimidine kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
ton  Thermococcus onnurineus
Brite
KEGG Orthology (KO) [BR:ton00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TON_1488
Enzymes [BR:ton01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TON_1488
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: ACJ16978
UniProt: B6YY15
Position
complement(1361712..1362605)
AA seq 297 aa
MDDGFDVIGIGNLNYDIIMLVERFPEFHEKVSAEKAFFGLGGAAANTISWLAHFGLKTGF
LGAIGRDEIGEAHLSYFRRIGVDTGGIRVVDAPSGIAVAMIHGEDKRIVKYPGANLMKEV
DFDYLARTRHIHLSSNPPEVIVKVVNFAHERDITVSLDIGEAHLPGEIEEKVDYLLMNED
EFRRKFGELDLSKARAENVIVTLNGGGALIRNENGEICEVKGLSAEVVDSTGAGDSFDAG
LIYGVLNGWKLNDAAKLGMLLAYLTVQKVGARTAIIPLEKVAKVAEELGLELPFRVQ
NT seq 894 nt   +upstreamnt  +downstreamnt
atggacgatgggttcgacgtgataggaatcggcaaccttaactacgatatcataatgctc
gtcgagcgttttccggagtttcatgagaaggtaagtgccgagaaggcctttttcggtctg
ggtggagcagcagccaacacgatctcctggctggcccactttgggctgaaaacgggcttt
ctcggtgccattggaagggacgagataggtgaggcgcacctttcttacttcagacggata
ggtgtcgacacgggtggtatacgagtcgtcgatgctccatcggggatagcagttgccatg
atacacggagaggacaagaggatagtgaagtaccccggcgccaacctcatgaaggaggtc
gattttgactaccttgctaggacaaggcacatccatctctcttcaaatccccctgaagtc
atagttaaggtagttaatttcgcacatgagagggacataacagtttctctggacataggg
gaagcacatcttcctggggaaatcgaggagaaggttgattacctcctaatgaacgaagac
gagttcaggaggaagttcggcgagctcgacctctctaaagctcgagcggaaaatgttatc
gtaactctcaacggagggggtgcattgattaggaatgaaaacggagagatctgcgaagtc
aaggggctgagcgcagaggtcgtcgattctaccggtgcaggtgattccttcgacgctggg
ttgatatacggcgttctcaatggatggaagctgaatgatgctgccaaactggggatgttg
cttgcttatctaactgttcagaaagttggtgcaagaacggccataattcctctggaaaag
gttgccaaggttgctgaagaacttggccttgagctgccatttcgagtccagtga

DBGET integrated database retrieval system