KEGG   Thermococcus pacificus: A3L08_03950
Entry
A3L08_03950       CDS       T05192                                 

Definition
(GenBank) RNA 3'-terminal-phosphate cyclase
  KO
K18105  RNA 3'-terminal phosphate cyclase (GTP) [EC:6.5.1.5]
Organism
tpaf  Thermococcus pacificus
Brite
KEGG Orthology (KO) [BR:tpaf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3L08_03950
Enzymes [BR:tpaf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.5  RNA 3'-terminal-phosphate cyclase (GTP)
     A3L08_03950
SSDB
Motif
Pfam: RTC RTC_insert
Other DBs
NCBI-ProteinID: ASJ06540
UniProt: A0A218P721
Position
709976..711010
AA seq 344 aa
MGWVEIDGSYGEGGGQILRTAVALSVITGKAVRIYNIRANRPNSGLKPQHLHGILALKEL
SGARVKGAQVGSTELEFIPGEAKPKHVRVPISTAGSITLVLQALLPAMAFVGGSFEVTGG
TDVPWSPPVDYLKHVTLFALGKMGLRVELEIRRRGHYPKGGGVVAGRVEPWEEKRPLVAL
EWEKVERFAGISHATNLPAHVAERQAKAARERIGELYNVPVEIETEVSRSLGPGSGIVVW
AETDMLRLGGDALGKRGKPAEVVGREAADELLDQLKTRAAVDKFLGDQLIPFLAFAGGEI
GVAEITNHLVTNVWVVEKFLGKVFEVEGEVGGPGVVRVVREVEV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggggtgggttgagatagacggttcctacggcgaaggtggcggacagatacttaggacc
gccgtggccctctcggttataaccggaaaagccgtgaggatatacaacattcgtgccaac
agaccaaattcgggccttaagccccagcacctccacggaatccttgccttgaaggagctg
agcggcgcgagggttaagggcgctcaggttggctcgaccgagctcgagttcatccccggg
gaagcaaagccaaagcacgtgcgcgtcccaataagcaccgccggcagtataacgctcgtt
ctccaggctttgcttccggccatggccttcgtcggcgggagctttgaggtaaccggtgga
accgacgtcccctggagtccgcccgtggactacctcaagcacgttaccctctttgcgctc
ggcaagatgggactgagggttgaactcgaaatcaggaggaggggccactacccaaaaggc
ggtggagttgttgctggcagggttgagccctgggaagagaaaaggccgttggtggcgttg
gaatgggagaaggtagaacgtttcgccggaataagccacgcaacaaacctgccggcccac
gttgctgagaggcaggcaaaggccgcaagggagagaattggggagctctacaacgttccg
gtggagatagagactgaagtgagccgttcactcggcccggggagcgggatagtggtctgg
gccgaaacggacatgctcaggctcggcggtgatgcccttgggaagcgaggcaaacccgct
gaagtcgtcggcagggaggcggcagacgaactcctcgaccagctgaagacccgggcggca
gttgataagttccttggcgaccagctgataccgttcttggccttcgccggcggggaaata
ggagttgcggagataaccaaccatctcgttaccaacgtctgggttgtcgagaagttcctc
gggaaggtcttcgaggttgagggagaggttggagggccgggggtggttagagtggtaagg
gaggtggaggtctga

DBGET integrated database retrieval system