KEGG   Tetrapisispora phaffii: TPHA_0J02590
Entry
TPHA_0J02590      CDS       T02235                                 

Symbol
TPHA0J02590
Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf03440  Homologous recombination
tpf03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    TPHA_0J02590 (TPHA0J02590)
   03450 Non-homologous end-joining
    TPHA_0J02590 (TPHA0J02590)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tpf03400]
    TPHA_0J02590 (TPHA0J02590)
DNA repair and recombination proteins [BR:tpf03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     TPHA_0J02590 (TPHA0J02590)
   NHEJ (non-homologous end-joining)
    MRX complex
     TPHA_0J02590 (TPHA0J02590)
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-GeneID: 11533179
NCBI-ProteinID: XP_003687513
UniProt: G8BYY7
Position
10:complement(574619..576946)
AA seq 775 aa
MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD
DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPITLEIFNQEVVCNSI
EDIQNSDSKLILNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSNVFGIPIVTIEE
LRGIANANDFYSYWDKIYSRKKNKGKACMLDLSTCYYISEVDKYVDYVKVAIRSLNAEIK
ILKDKDDLVKDIRKNISKGNISKFFVLSNDITQGEEAPFNISVTSIAKLLEAVKTNNMKD
IVMHDYSSFKIEIPREVKSPKDDNIIEKQEPPAPKRRRMNRSKVKPLDTLSFFAGGMSHD
THSINTKPSNDVQSHQETEKDVNNSKIESIQDVESNQDQTKYDKSTELQKSKAVSKNADD
KLQDSTAEKPINFNPTTKTPSFSPSINDKAIENSNANLDPTMEKTRVNKKPASLDTKNNL
LDNKLIAEQINEALSAKTNDAPVVRRRRTLLDYGNTDKSSSTDLVRTIQNVKSRGVDRVN
SKIVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNAQKVIDNANIDHNSNFKNRKDYK
LFKKSIPKWQSKLNKQHHSMTSDNGENLVVSKNRNKIPLRKYNENEKIHEADIFEFESSK
KTENPESLPKNNNEMEEKEREINAHTLTFSENSSNNKLFYQEEDEDEEQYGVDVPISSNA
NHHSVQMNNNDILQENNTSFSDIRQNSDLTKHNFNSIPDDSDDDSDDEPKFKFNR
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgataattctacgatataagaatgtcttggctgatgggccagttaatgtcgtgtcttgt
tgtttactgtgcgatgttgagtatgcaattgggagatcaagtaagaataaatttgcaatt
aagaatgataagagtatctcgaggcagcatgtaagtttattatggaaatactcgagtgat
gataaaaacgtgataatacagatcaagaacttcgggaaagttactatgataaaggataag
tatttatctcaagatgaaactttacaattcacacttatcgataagaaacttgaagtgaat
attggtacaagccctataacattggaaatctttaaccaagaagttgtatgcaattcgatt
gaggatattcaaaatagtgattcaaaattaatcttaaataatctaaacatactgcaagat
gatccattaaccttaaaaagagaaggaccaacaataattattaaagagaatagttatact
gacatattgcttgaattgtttagcaatgtatttggaattccaatagttaccattgaagaa
ttaagaggtatagccaacgctaatgatttttattcatattgggataaaatatattctaga
aagaagaacaagggtaaagcatgcatgttagatttatccacttgttattatatttctgag
gtagataaatacgttgattatgtcaaagttgctatacgttcattaaatgcagaaataaag
atattaaaagataaagatgatttggtgaaagatatacgtaaaaatataagcaagggaaat
atctctaaattttttgtattaagcaatgacataactcagggagaagaggcaccatttaat
atttctgtgacatcgatagcaaagcttttagaggcggttaaaaccaataacatgaaggat
attgttatgcatgactatagttcttttaaaattgagatacctagagaagttaaaagtccc
aaagatgacaatataattgaaaaacaggaacctcctgcacctaaaagaagaagaatgaat
agatccaaggtcaaacctttagatactttatcattttttgctggcggaatgtctcatgat
actcattctataaacactaaaccatcaaatgatgtccaatctcatcaagaaactgaaaaa
gatgtaaataattctaaaattgagagcatacaagatgtagaaagtaaccaagatcaaact
aagtatgacaaaagtacagaattacagaaaagcaaagctgtttcaaagaatgctgatgat
aaactgcaagatagcacagctgaaaagccaataaactttaatccaaccactaaaactcca
agcttctcaccttcaattaatgataaagcgatagaaaattctaatgctaatcttgaccca
acaatggaaaagacaagagtaaataaaaagccagcttcattagatactaagaataatctt
ctcgacaataagttaatagctgagcaaatcaatgaagcattatctgccaaaacgaatgat
gctcctgtcgtaaggcggcgaagaacattattagactacggtaatacagataaaagttca
agcaccgatttagtgagaacaatccaaaatgtaaagtcaagaggggttgacagagtaaat
tcaaaaatagttactgttgatgaaaatgaattaaacgaagaggaattgaataaattcttc
gatgtagtcgtagttgatgtgaatgataaacttatgaaaaaacatcctaatgcacaaaag
gttattgacaatgcgaatatcgatcataactcgaattttaaaaatagaaaagactataaa
ctatttaagaaaagtatacctaaatggcaatcaaaattaaacaaacaacatcatagcatg
acaagtgataatggagaaaatttagttgtttcaaaaaacagaaataagattcctctaaga
aaatataatgaaaatgaaaaaatccatgaagctgatatattcgaattcgaatcatcaaag
aaaacagaaaatccagaatcgttaccaaaaaataataatgaaatggaagagaaagaaaga
gaaattaatgcacatactttaacattcagtgaaaattccagtaataataaattattttac
caagaagaggatgaggatgaagagcagtatggagtcgatgttcctatttctagtaatgca
aatcatcactcagtacagatgaataacaatgatatcttacaggaaaataatacttcattt
tcggatattagacaaaattcagatttaacaaaacacaattttaattccattcctgacgat
tccgatgacgattccgatgacgagccaaagtttaaattcaatcgttaa

DBGET integrated database retrieval system