KEGG   Thalassiosira pseudonana: THAPS_23391
Entry
THAPS_23391       CDS       T01078                                 
Symbol
DES11
Name
(RefSeq) microsomal delta-5 desaturase
  KO
K18247  Delta11-fatty-acid desaturase [EC:1.14.19.5]
Organism
tps  Thalassiosira pseudonana
Brite
KEGG Orthology (KO) [BR:tps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    THAPS_23391 (DES11)
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.5  acyl-CoA 11-(Z)-desaturase
     THAPS_23391 (DES11)
SSDB
Motif
Pfam: FA_desaturase Cyt-b5
Other DBs
NCBI-GeneID: 7446227
NCBI-ProteinID: XP_002296094
JGI: 23391
UniProt: B5YMH5
Position
7:complement(501600..504975)
AA seq 477 aa
MDFLSGDPFRTLVLAALVVIGFAAAWQCFYPPSIVGKPRTLSNGKLNTRIHGKLYDLSSF
QHPGGPVALSLVQGRDGTALFESHHPFIPRKNLLQILSKYEVPSTEDSVSFIATLDELNG
ESPYDWKDIENDDFVSDLRALVIEHFSPLAKERGVSLVESSKATPQRWMVVLLLLASFFL
SIPLYLSGSWTFVVVTPILAWLAVVNYWHDATHFALSSNWILNAALPYLLPLLSSPSMWY
HHHVIGHHAYTNISKRDPDLAHAPQLMREHKSIKWRPSHLNQTQLPRILFIWSIAVGIGL
NLLNDVRALTKLSYNNVVRVEKMSSSRTLLHFLGRMLHIFVTTLWPFLAFPVWKAIVWAT
VPNAILSLCFMLNTQINHLTNTCAHASDNNFYKHQVVTAQNFGRSSAFCFIFSGGLNYQI
EHHLLPTVNHCHLPALAPGVERLCKKHGVTYNSVEGYREAIIAHFAHTKDMSTKPTD
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggactttctctccggcgatcccttccggacactcgtccttgcagcacttgttgtcatc
ggatttgctgcggcgtggcaatgcttctacccgccgagcatcgtcggcaagcctcgtaca
ttaagcaatggtaaactcaataccagaatccatggcaaattgtacgacctctcatcgttt
cagcatccaggaggccccgtggctctttctcttgttcaaggtcgcgacggaacagctcta
tttgagtcacaccatcccttcatacctcgaaagaatctacttcagatcctctccaagtac
gaggttccgtcgactgaagactctgtttccttcatcgccaccctagacgaactcaatggt
gaatctccgtacgattggaaggacattgaaaatgatgatttcgtatctgacctacgagct
ctcgtaattgagcacttttctcctctcgccaaggaaaggggagtttcactcgttgagtcg
tcgaaggcaacacctcagcggtggatggtggttctactgctccttgcgtcgttcttcctc
agcatcccattatatttgagtggttcgtggactttcgttgtcgtcactcccatcctcgct
tggctggcggttgtcaattactggcacgatgctactcactttgcattgagcagcaactgg
attttgaatgctgcgctcccatatctcctccctctcctatcgagtccgtcaatgtggtat
catcatcacgtcattggacatcacgcatacaccaacatttccaaaagagatccagatctt
gctcacgctccacaactcatgagagaacacaagagtatcaaatggagaccatctcactta
aatcaaacacagcttccgcggattctcttcatctggtcgattgcagtcggtattgggttg
aacttactgaacgacgtgagagcactaaccaagctttcatacaacaacgttgttcgggtg
gagaagatgtcatcgtcgcgaacattactccatttccttggacgtatgttgcacatcttt
gtgactacactttggccctttttggcgtttccggtgtggaaggccatcgtttgggcgact
gtaccgaatgccatactgagtttgtgcttcatgctgaatacgcaaatcaatcacctcacc
aacacgtgtgcacatgcttccgataacaacttttacaagcatcaagttgtaactgctcag
aactttggccgatcaagtgccttttgcttcatcttctcgggaggtctcaactaccaaatt
gaacatcatttgttgccgacggtgaaccattgccatttgccagctttggccccgggtgta
gagcgtttgtgtaagaaacacggggtgacatacaactctgttgaaggatacagagaggcc
atcattgcacactttgcacataccaaagatatgtcgacgaagcctactgattga

DBGET integrated database retrieval system