KEGG   Thermococcus sibiricus: TSIB_1368
Entry
TSIB_1368         CDS       T00928                                 

Name
(GenBank) Carbohydrate/pyrimidine kinase, PfkB family
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
tsi  Thermococcus sibiricus
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TSIB_1368
Enzymes [BR:tsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TSIB_1368
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: ACS90419
UniProt: C6A474
Position
1226634..1227581
AA seq 315 aa
MEKVSPPEKNKSIDLQKKSEVGKVFDIVAIGNLNYDVTLLVERFPEFHEKVIAKKAHFGL
GGAAGNTASWLSQMGLKVGFIGAVGNDEIGEAHISYFKKIGVDVEGIKVVNEPSGIAISM
IKNEDKRIVKHLGANAHREIDLEYLSRARYIHMSSNPKEIIEKTAKFAHKRDIPVFLDIG
EAELPKSVEDKITYLLMNEDEFKRKYGSLENLQAVKSKNLIITLNGGGALLRNERGEIFK
VKGLSAKVIDSTGAGDAFDAGFIYGIIKGWRLKEAATLGTFLAYLSVQKVGARTAIIGIE
EIKKKAKELNIELPF
NT seq 948 nt   +upstreamnt  +downstreamnt
atggaaaaagtctccccacccgaaaaaaataaatctattgacctacaaaaaaagagcgag
gtggggaaggtgtttgatatagttgcaattggtaaccttaactatgatgtcactctttta
gtagagagatttcctgaatttcatgaaaaggtaatcgccaagaaagcccattttggatta
ggtggagctgcaggcaatactgcctcctggctctctcaaatgggccttaaagttggattt
atcggtgctgtgggcaatgacgagattggagaggcccatataagttacttcaaaaaaata
ggagttgatgtagaaggaattaaagtggtgaacgagccctctggcatagcaatatccatg
ataaagaacgaagataagagaatcgtcaagcatctgggagcaaacgcccacagagaaatt
gatctggaatacttatcgagagcgagatacattcacatgtcttcaaatccaaaggagatt
atagaaaagacagcgaaattcgcccataagagggatatacctgtttttcttgatataggg
gaggcagagcttcccaaatcagttgaagataagatcacctaccttctgatgaatgaagat
gagttcaaacgaaagtatggaagtttagagaatctccaagctgtaaaaagcaaaaattta
ataataaccctgaatggtggtggtgccttgctccgaaatgaaagaggagaaatcttcaaa
gttaaaggattaagcgctaaagtcatcgactccacgggggccggagatgccttcgatgcc
ggatttatttacggtataataaagggatggagattgaaagaagccgcaactttaggaact
tttctagcatatttaagtgtccagaaagtaggggccagaaccgcaataataggcattgaa
gaaattaaaaagaaagccaaggaacttaatatagaactcccattttaa

DBGET integrated database retrieval system