KEGG   Thioalkalivibrio paradoxus: THITH_13335
Entry
THITH_13335       CDS       T03590                                 

Definition
(GenBank) hypothetical protein
  KO
K24299  thiocyanate desulfurase [EC:1.8.2.7]
Organism
tti  Thioalkalivibrio paradoxus
Brite
KEGG Orthology (KO) [BR:tti00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    THITH_13335
Enzymes [BR:tti01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.2  With a cytochrome as acceptor
    1.8.2.7  thiocyanate desulfurase
     THITH_13335
Motif
Pfam: Cytochrom_D1 UCR_Fe-S_N Oxidoreduct_C
Other DBs
NCBI-ProteinID: AHE99077
UniProt: W0DP94
Structure
PDB: 

Position
complement(2886123..2887769)
AA seq 548 aa
MSNSDHIDGKDLSEPNIAAETAEGSVEDTGASESRRKFLKTVGIGTGAAFAATAAAPFMP
ESVRGLVTQDAQAQIFGRSGSKYVKVQDFYDQLGKYVLVAPGKFSGTVAATDLSTGWTMA
WLAAWNYGDTCPIMHHMAAFPSPDPYKEFEFVVNTQGGKNLFIYGVPVTVEDPGEGMKIY
RIKYDGTRMNLQRDAAEVSGLGLGVHVTITPEADGYAVGDGQKDICAEFDRETDMVRYAW
AFDWDPNVKDLKRAWLDGGTMTIKRLKPTLPGGRYDLQGSKGNKIDWELVPGGELAIEDG
KVSGDRPLHSVANDALVFDPRGKWAVASMRLPGVCVVFDRENQVPVAVLAGPKGTPSQFQ
LVKVDDDTWTVDIPEVISAGHQAGFSPDGQSFLFMNSLRQNNIMVWDSSNHDDPTTWEKK
AVVESPDWRGAYPNTFHMVFTPDAKKIYVTMWWPSPTPNGIAVIDAVNWEVLKEVDLGPD
MHTLAITYDGKFVVGTLSGYQNTASAIVVMETETDEVLGFLPSPMGHHDNVIVPRTLEDL
RISRSTTT
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgagcaattccgaccatatcgatggcaaggatctgtccgagccaaacatcgccgcggag
accgccgaaggtagcgtggaggacacgggggcatcggagtcccggcgcaagtttctgaag
accgtcgggatcggcactggcgccgcgttcgctgccaccgccgccgccccgttcatgccc
gagagcgtccgtggtctggtgacccaggacgcccaggcgcagatcttcggccgcagcggc
agcaagtacgtcaaggtccaggacttctacgaccagctcggcaagtacgtcctggttgcc
ccgggcaagttctccggcacggtcgctgccactgacctcagcaccggctggacgatggcc
tggttggccgcgtggaactacggcgacacctgcccgatcatgcaccacatggcggctttc
ccgtccccggacccctacaaggagttcgagttcgtggtgaacacccagggcggcaagaac
ctgttcatctacggtgtgccggtcacggtggaagacccgggcgagggcatgaagatctac
cgcatcaagtacgacgggacgcgcatgaacctgcagcgcgatgccgccgaggtcagcggt
ctggggctgggtgtgcacgtgacgatcacccccgaagccgacggttatgcagtgggcgac
gggcagaaggacatctgcgccgagttcgatcgcgagaccgatatggtccgatacgcctgg
gccttcgactgggatccgaacgtcaaggacctgaagcgcgcctggctcgacggcggcacc
atgaccatcaaacgcctgaagccgacgctgcccggcggtcgctacgacctgcagggctcc
aagggcaacaagatcgactgggaactcgtccctggcggcgagctcgcgatcgaggacggc
aaggtttcgggcgatcgtccgctgcactccgttgcgaacgatgcgctggtgttcgacccg
cgcggcaagtgggcggtcgcgtcgatgcgtctgcctggtgtctgcgtcgtgttcgaccgc
gagaaccaggtgccggtggcggtcctcgccgggccgaagggcacgccttcgcagttccag
ctggtcaaggtcgatgacgacacctggaccgtggacattcccgaggtgatcagtgccggg
caccaggcgggcttctcgcccgacggccagagcttcctgttcatgaacagcctgcgccag
aacaacatcatggtctgggacagctccaaccacgacgaccccacgacctgggagaagaag
gcggtcgtcgagagccccgattggcgcggcgcctacccgaacaccttccacatggtgttc
acgccggacgcgaagaagatctacgtcacgatgtggtggccgtcgccgaccccgaacggg
atcgctgtgatcgacgcggtcaactgggaagtgctgaaggaggtcgacctcggccccgac
atgcatacactggcgattacctacgacggcaagttcgtcgtcggcacgctttccggttac
cagaacacggcgtccgcgatcgtggtcatggaaaccgagaccgacgaggtcctcggcttc
ctgcccagcccgatggggcaccacgacaacgtgatcgtgccccgcacgctggaggacctg
cggatcagccgctccaccacgacctga

DBGET integrated database retrieval system