KEGG   Trichosurus vulpecula (common brushtail): 118848204
Entry
118848204         CDS       T10126                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp01521  EGFR tyrosine kinase inhibitor resistance
tvp01522  Endocrine resistance
tvp01524  Platinum drug resistance
tvp04012  ErbB signaling pathway
tvp04014  Ras signaling pathway
tvp04015  Rap1 signaling pathway
tvp04024  cAMP signaling pathway
tvp04062  Chemokine signaling pathway
tvp04066  HIF-1 signaling pathway
tvp04068  FoxO signaling pathway
tvp04070  Phosphatidylinositol signaling system
tvp04071  Sphingolipid signaling pathway
tvp04072  Phospholipase D signaling pathway
tvp04081  Hormone signaling
tvp04140  Autophagy - animal
tvp04145  Phagocytosis
tvp04150  mTOR signaling pathway
tvp04151  PI3K-Akt signaling pathway
tvp04152  AMPK signaling pathway
tvp04210  Apoptosis
tvp04211  Longevity regulating pathway
tvp04213  Longevity regulating pathway - multiple species
tvp04218  Cellular senescence
tvp04360  Axon guidance
tvp04370  VEGF signaling pathway
tvp04380  Osteoclast differentiation
tvp04510  Focal adhesion
tvp04517  IgSF CAM signaling
tvp04518  Integrin signaling
tvp04550  Signaling pathways regulating pluripotency of stem cells
tvp04611  Platelet activation
tvp04613  Neutrophil extracellular trap formation
tvp04620  Toll-like receptor signaling pathway
tvp04625  C-type lectin receptor signaling pathway
tvp04630  JAK-STAT signaling pathway
tvp04650  Natural killer cell mediated cytotoxicity
tvp04660  T cell receptor signaling pathway
tvp04662  B cell receptor signaling pathway
tvp04664  Fc epsilon RI signaling pathway
tvp04666  Fc gamma R-mediated phagosome formation
tvp04668  TNF signaling pathway
tvp04670  Leukocyte transendothelial migration
tvp04722  Neurotrophin signaling pathway
tvp04725  Cholinergic synapse
tvp04750  Inflammatory mediator regulation of TRP channels
tvp04810  Regulation of actin cytoskeleton
tvp04910  Insulin signaling pathway
tvp04914  Progesterone-mediated oocyte maturation
tvp04915  Estrogen signaling pathway
tvp04917  Prolactin signaling pathway
tvp04919  Thyroid hormone signaling pathway
tvp04923  Regulation of lipolysis in adipocytes
tvp04926  Relaxin signaling pathway
tvp04929  GnRH secretion
tvp04930  Type II diabetes mellitus
tvp04931  Insulin resistance
tvp04932  Non-alcoholic fatty liver disease
tvp04933  AGE-RAGE signaling pathway in diabetic complications
tvp04935  Growth hormone synthesis, secretion and action
tvp04960  Aldosterone-regulated sodium reabsorption
tvp04973  Carbohydrate digestion and absorption
tvp05010  Alzheimer disease
tvp05017  Spinocerebellar ataxia
tvp05020  Prion disease
tvp05100  Bacterial invasion of epithelial cells
tvp05135  Yersinia infection
tvp05142  Chagas disease
tvp05146  Amoebiasis
tvp05160  Hepatitis C
tvp05161  Hepatitis B
tvp05162  Measles
tvp05163  Human cytomegalovirus infection
tvp05164  Influenza A
tvp05165  Human papillomavirus infection
tvp05166  Human T-cell leukemia virus 1 infection
tvp05167  Kaposi sarcoma-associated herpesvirus infection
tvp05168  Herpes simplex virus 1 infection
tvp05169  Epstein-Barr virus infection
tvp05170  Human immunodeficiency virus 1 infection
tvp05171  Coronavirus disease
tvp05200  Pathways in cancer
tvp05203  Viral carcinogenesis
tvp05205  Proteoglycans in cancer
tvp05206  MicroRNAs in cancer
tvp05207  Chemical carcinogenesis - receptor activation
tvp05208  Chemical carcinogenesis - reactive oxygen species
tvp05210  Colorectal cancer
tvp05211  Renal cell carcinoma
tvp05212  Pancreatic cancer
tvp05213  Endometrial cancer
tvp05214  Glioma
tvp05215  Prostate cancer
tvp05218  Melanoma
tvp05220  Chronic myeloid leukemia
tvp05221  Acute myeloid leukemia
tvp05222  Small cell lung cancer
tvp05223  Non-small cell lung cancer
tvp05224  Breast cancer
tvp05225  Hepatocellular carcinoma
tvp05226  Gastric cancer
tvp05230  Central carbon metabolism in cancer
tvp05231  Choline metabolism in cancer
tvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tvp05415  Diabetic cardiomyopathy
tvp05417  Lipid and atherosclerosis
tvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    118848204
   04014 Ras signaling pathway
    118848204
   04015 Rap1 signaling pathway
    118848204
   04370 VEGF signaling pathway
    118848204
   04630 JAK-STAT signaling pathway
    118848204
   04668 TNF signaling pathway
    118848204
   04066 HIF-1 signaling pathway
    118848204
   04068 FoxO signaling pathway
    118848204
   04070 Phosphatidylinositol signaling system
    118848204
   04072 Phospholipase D signaling pathway
    118848204
   04071 Sphingolipid signaling pathway
    118848204
   04024 cAMP signaling pathway
    118848204
   04151 PI3K-Akt signaling pathway
    118848204
   04152 AMPK signaling pathway
    118848204
   04150 mTOR signaling pathway
    118848204
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    118848204
   04517 IgSF CAM signaling
    118848204
   04518 Integrin signaling
    118848204
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagocytosis
    118848204
   04140 Autophagy - animal
    118848204
  09143 Cell growth and death
   04210 Apoptosis
    118848204
   04218 Cellular senescence
    118848204
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118848204
   04550 Signaling pathways regulating pluripotency of stem cells
    118848204
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118848204
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    118848204
   04613 Neutrophil extracellular trap formation
    118848204
   04620 Toll-like receptor signaling pathway
    118848204
   04625 C-type lectin receptor signaling pathway
    118848204
   04650 Natural killer cell mediated cytotoxicity
    118848204
   04660 T cell receptor signaling pathway
    118848204
   04662 B cell receptor signaling pathway
    118848204
   04664 Fc epsilon RI signaling pathway
    118848204
   04666 Fc gamma R-mediated phagosome formation
    118848204
   04670 Leukocyte transendothelial migration
    118848204
   04062 Chemokine signaling pathway
    118848204
  09152 Endocrine system
   04910 Insulin signaling pathway
    118848204
   04923 Regulation of lipolysis in adipocytes
    118848204
   04929 GnRH secretion
    118848204
   04915 Estrogen signaling pathway
    118848204
   04914 Progesterone-mediated oocyte maturation
    118848204
   04917 Prolactin signaling pathway
    118848204
   04926 Relaxin signaling pathway
    118848204
   04935 Growth hormone synthesis, secretion and action
    118848204
   04919 Thyroid hormone signaling pathway
    118848204
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    118848204
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    118848204
  09156 Nervous system
   04725 Cholinergic synapse
    118848204
   04722 Neurotrophin signaling pathway
    118848204
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    118848204
  09158 Development and regeneration
   04360 Axon guidance
    118848204
   04380 Osteoclast differentiation
    118848204
  09149 Aging
   04211 Longevity regulating pathway
    118848204
   04213 Longevity regulating pathway - multiple species
    118848204
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118848204
   05206 MicroRNAs in cancer
    118848204
   05205 Proteoglycans in cancer
    118848204
   05207 Chemical carcinogenesis - receptor activation
    118848204
   05208 Chemical carcinogenesis - reactive oxygen species
    118848204
   05203 Viral carcinogenesis
    118848204
   05230 Central carbon metabolism in cancer
    118848204
   05231 Choline metabolism in cancer
    118848204
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118848204
  09162 Cancer: specific types
   05210 Colorectal cancer
    118848204
   05212 Pancreatic cancer
    118848204
   05225 Hepatocellular carcinoma
    118848204
   05226 Gastric cancer
    118848204
   05214 Glioma
    118848204
   05221 Acute myeloid leukemia
    118848204
   05220 Chronic myeloid leukemia
    118848204
   05218 Melanoma
    118848204
   05211 Renal cell carcinoma
    118848204
   05215 Prostate cancer
    118848204
   05213 Endometrial cancer
    118848204
   05224 Breast cancer
    118848204
   05222 Small cell lung cancer
    118848204
   05223 Non-small cell lung cancer
    118848204
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118848204
   05170 Human immunodeficiency virus 1 infection
    118848204
   05161 Hepatitis B
    118848204
   05160 Hepatitis C
    118848204
   05171 Coronavirus disease
    118848204
   05164 Influenza A
    118848204
   05162 Measles
    118848204
   05168 Herpes simplex virus 1 infection
    118848204
   05163 Human cytomegalovirus infection
    118848204
   05167 Kaposi sarcoma-associated herpesvirus infection
    118848204
   05169 Epstein-Barr virus infection
    118848204
   05165 Human papillomavirus infection
    118848204
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    118848204
   05100 Bacterial invasion of epithelial cells
    118848204
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    118848204
   05142 Chagas disease
    118848204
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118848204
   05017 Spinocerebellar ataxia
    118848204
   05020 Prion disease
    118848204
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118848204
   05418 Fluid shear stress and atherosclerosis
    118848204
   05415 Diabetic cardiomyopathy
    118848204
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    118848204
   04932 Non-alcoholic fatty liver disease
    118848204
   04931 Insulin resistance
    118848204
   04933 AGE-RAGE signaling pathway in diabetic complications
    118848204
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118848204
   01524 Platinum drug resistance
    118848204
   01522 Endocrine resistance
    118848204
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tvp04131]
    118848204
Membrane trafficking [BR:tvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    118848204
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH2_1 DicA_C ODF2_C Transcrip_act
Other DBs
NCBI-GeneID: 118848204
NCBI-ProteinID: XP_036612912
Position
4:33257127..33320932
AA seq 476 aa
MYTPPWGMEREDGGEGEGEGGEGGEGEDWRDVTMPYSTELIFYIEMDPPALPPKPPKSLT
QAGANGMKDSSGFSLPDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKVQGDYTLTLR
KGGNNKLIKIYHRDGKYGFSDPLTFASVVELINHYRHESLAQYNPKLDVKLMYPISRYQQ
DQLVKEDNIDAVGTKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKI
FEEQCQTQERQSKDYIERFRREGNEKEIERIMMNYEKLKSRLGEIHDSKMRLEQDLKKQA
LDNRETDKKMNSIKPDLIQLRKIRDQYLVWLSHKGVRQKRLNDWLGIKNDHIDETYFMNE
EDENLPHYDEKTWFVGDLNRLQAEDLLHGKPDGAFLIRESSKKGCYACSVVADGDVKHCV
IYSTARGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVRLAHPVYAQLPSHCR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtacacgccgccgtggggcatggagcgcgaggacggcggggaaggcgaaggcgaaggt
ggcgagggcggcgaaggcgaggactggagggacgtgaccatgccctactccactgagctc
atcttctacatcgagatggaccccccagctcttccgccaaagccacccaaatccttgact
caagccggtgccaatgggatgaaggacagctcgggtttttcccttcctgacgcagagtgg
tactggggagacatctcaagggaagaggtcaatgacaaactacgcgacatgcccgatggc
actttcttggtgcgtgatgcatccaccaaggtgcagggagactacactctgactctgcgg
aagggaggcaataataaattgattaagatttatcatcgggatggcaaatatggcttctct
gacccgctgaccttcgcttcggtggtggagctgatcaaccactaccgccacgagtctctg
gcccagtacaaccccaagctcgatgtgaagctgatgtaccccatctccaggtaccagcag
gatcagctggtgaaagaagacaacatcgatgccgttggcaccaaactgcaggaataccac
tcccagtaccaagagaagagcaaagagtatgaccggctgtatgaggagtacaccaggacc
tcccaggaaattcagatgaagaggacagcaatcgaagcttttaatgaaacaattaagatc
tttgaggagcagtgccagacccaggagcgccaaagcaaagactacattgagcggtttcgg
agagaggggaatgaaaaggagattgagcggataatgatgaattatgagaaactgaaatca
cgtctgggtgagattcatgacagcaaaatgcgcttggagcaggatttgaagaagcaagct
ttggataaccgagaaactgacaaaaaaatgaacagcatcaaacccgacctgattcagctg
cgcaagattcgtgaccagtacctagtatggctcagtcacaaaggggtgagacagaaacga
ctgaatgactggctgggaatcaaaaacgaccacattgatgagacctattttatgaatgag
gaagatgaaaatctgccacattatgatgagaaaacatggtttgtcggggatctcaatcga
ctccaagcagaggacctgctccatgggaagcccgatggagcctttttaattcgcgagagt
agcaagaaaggatgctatgcctgctctgtggtggcggatggggacgtgaagcactgtgtg
atctacagcacggcccgtggctatggctttgcggagccctacaacctgtatggcagcctg
aaggagctggttctgcactaccagcacacgtccctggtccagcacaacgactcgctcaat
gtccggctggcccacccagtctacgcacagctgccctcccactgcagatag

DBGET integrated database retrieval system