KEGG   Tripterygium wilfordii: 119980547
Entry
119980547         CDS       T07256                                 

Name
(RefSeq) terpene synthase 10-like isoform X1
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
twl  Tripterygium wilfordii
Pathway
twl00902  Monoterpenoid biosynthesis
twl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:twl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    119980547
Enzymes [BR:twl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     119980547
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 119980547
NCBI-ProteinID: XP_038679210
Position
16
AA seq 587 aa
MAASCFVTSTVFFPSQINNNRYTSTTHSTRVFCKITKTKAKQHCDDSKVVVRRSADYQPS
VWDDNYLQSLNNDFMGEAHKRRVENLKGKARILLNNAGGPSHQLELIDTLQRLGLGYNFK
LEIETILHNIYSKTKTNHLGNLYVTAIQFRLLREHGYHVPQEVFENFKDETGDFKECVGG
DDVRGILSLYEASYYSVEGESIMEEAWDFATRHLKKLDDERVLDGRDPILAMQVRHALEL
PLHWRRTRFEARWFIDLYEKTNDMNPMLLELAKLDFNILQGMYKEELKDLSRWWKNCGLV
EKLSFARDRLVASHLWAIGIADEPQFANCRKVITKVIALITVIDDVYDVYGTLDELKLFT
DVVERWDINAIKQLPDYLKICFFALFNTVNEMAFDILKEHGLDVLPNLKKAWIDLMNAYL
VEAEWFHGGYKPTLEEYMNNGVFSITGPSITSHGYLFSAKPIRETDLNFLENDPDFVRHF
SCIFRLQDDLGTSSDELQRGDVPKSIQCYMNETGACEEDARKYIKELMRKTWKKTNAVDC
VLPQSAIVVMSNLARTSHCMYRYGDGHGVEDHVSKTRACSMLFEPIH
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggcagcttcttgctttgttacatcaactgtgttcttcccttcccaaatcaacaacaat
cgctatacttcaactactcacagtacccgagtcttttgcaagattacaaagacaaaagca
aaacaacattgtgatgattcaaaggttgtggtaaggagatcagcagactaccaacccagc
gtctgggatgacaattacttacaatcattgaacaatgactttatgggagaggcacacaaa
agaagagttgagaatctgaaaggaaaagcaagaattttgctgaataatgcagggggcccg
tcgcatcaattggaacttattgacactttacaaaggcttggattgggttataatttcaaa
ttggagatagagaccatactacataacatctactctaaaactaagaccaatcatcttgga
aatctctatgtcactgctattcaatttagactcctcagagaacatggatatcatgttccc
caagaggtatttgagaatttcaaggacgaaacaggcgatttcaaggaatgtgttggtggc
gatgatgtaaggggaattttgagcttatatgaagcatcatattactctgtagaaggggag
agtattatggaggaagcatgggactttgctactagacatctcaaaaaactagatgatgag
agagtactagatggccgcgatccgattctggcaatgcaggtaaggcatgccttggagctt
ccactacactggaggcgaacaagatttgaggcaaggtggttcatagacttgtatgagaaa
acaaatgacatgaacccaatgttgctagagcttgcgaagttggacttcaacattttgcaa
ggcatgtacaaggaggaactcaaggacctctcaaggtggtggaagaattgtggtttggta
gagaaattgagttttgcgagggaccggttggtcgcatcgcacttgtgggcaattgggatt
gctgatgagcctcagtttgcaaactgtaggaaagtgattacaaaggtgattgcactaatc
acagtgattgatgatgtttatgatgtctatggtaccttggatgaactcaaactcttcacg
gatgttgttgaaaggtgggacattaatgcaataaaacagctccctgactacctcaaaata
tgtttctttgcccttttcaacactgtcaatgaaatggctttcgatattctgaaagaacat
ggccttgatgtcttgcctaacctaaagaaagcatggatagatttaatgaatgcatacttg
gtagaggcagaatggtttcatggcggatacaagccaacactggaagaatacatgaacaat
ggagtcttttcaatcactggaccttcaatcacttctcatggatatctcttttcagcaaaa
cccatacgagagaccgatttgaatttcctcgaaaacgatccagattttgttcgccatttt
tcttgtatctttcggcttcaagatgatttgggaacttcatcagatgaactgcagagaggc
gatgtcccgaaatcgatccaatgctacatgaatgaaactggtgcatgcgaggaggacgcc
cgcaaatacattaaggagttgatgagaaagacatggaagaagaccaatgctgtagactgt
gtattacctcaatctgccattgttgtaatgtcaaatcttgccagaacctcccattgtatg
tataggtatggtgatggtcacggcgttgaagaccatgtgtccaagactcgagcctgttca
atgctttttgagccaattcattag

DBGET integrated database retrieval system