KEGG   Candidatus Uabimicrobium amorphum: UABAM_05678
Entry
UABAM_05678       CDS       T07685                                 
Name
(GenBank) GDP-perosamine synthase
  KO
K13547  L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase [EC:2.6.1.100 2.6.1.101]
Organism
uam  Candidatus Uabimicrobium amorphum
Pathway
uam00524  Neomycin, kanamycin and gentamicin biosynthesis
uam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uam00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UABAM_05678
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:uam01007]
    UABAM_05678
Enzymes [BR:uam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.100  L-glutamine:2-deoxy-scyllo-inosose aminotransferase
     UABAM_05678
    2.6.1.101  L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase
     UABAM_05678
Amino acid related enzymes [BR:uam01007]
 Aminotransferase (transaminase)
  Others
   UABAM_05678
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase
Other DBs
NCBI-ProteinID: BBM87275
UniProt: A0A5S9F5W1
Position
7992185..7993426
AA seq 413 aa
MAKLAINGGQAVRSQPFSQWPCWDDSDKEALIEVLEKGSWGGYPAPNTFAGKFAEEFARF
TGAQYGVCGANGSVTLEMAILAAGIEPGSEIIVPAYTFVATASAVVFCHAIPIFVDVDPH
TYCIDPQLIEAAITPKTRAIIPVHLACNMADMDAIIEIAAKHNLVVIEDCAHAHGARWKG
KGAGAIGDFGSFSFQTSKLMTAGEGGIVLTNDKQYEMRLQSVANCGRKEPQYEDYEGAIL
GKNYRITEWSAGMLLSQLKKLEQQTLQRIRMAGYFEEKLRGMPGISFTKQDSRNDRRAIY
QFIVKYDEKEFKNIPRDRFLQALNADGIPAEGDFYVPLYDCEIFPMDKKSNPLAFLPYAK
DYSFESFDCPVTERAAHREAIWLPHYLFLGTEKDMDDIVAAFTKIGENLDELA
NT seq 1242 nt   +upstreamnt  +downstreamnt
gtggcaaaattagcaatcaatggtgggcaggccgtaagatcacagcctttttcgcaatgg
ccatgttgggatgatagtgacaaagaagcactgatcgaagttttagaaaagggaagttgg
ggaggatatcccgcccccaatacatttgcgggtaaatttgccgaagaatttgcgcgtttt
acaggtgcacagtacggtgtttgtggtgcaaacggttctgttactctggaaatggcgatt
ctcgcagcaggtattgaaccaggaagtgaaattattgtccctgcatatacatttgtcgcc
acggcatcagcggttgttttttgccacgccataccgatttttgtcgatgttgatcctcac
acttattgcatagatccacagttaatcgaagcggcgattacccctaaaacgcgtgccatt
attcccgtacaccttgcctgcaacatggcagacatggatgcgatcatagaaatcgccgct
aagcacaatttagttgttattgaagattgcgctcatgcacatggcgcacgctggaaaggc
aaaggagccggggcaattggtgattttggttccttttcctttcagacgtccaaattgatg
accgcgggtgaaggtggaattgttctcactaatgacaaacaatatgaaatgcgcttgcaa
tccgtagccaattgtgggcgcaaggaaccgcaatatgaagattatgaaggggcgatactg
ggaaaaaattatcgcatcaccgagtggtcggcaggtatgttgctttcacagctcaaaaag
ctggagcaacaaacgcttcagcgtatacgcatggcgggttacttcgaagagaaattacgt
ggtatgcctggtatttcgtttaccaaacaagactcacgtaatgatcgacgtgccatctat
caatttattgtcaaatatgacgaaaaagaattcaaaaatattcctcgcgatcgtttttta
caagcactcaacgccgatggcattcctgccgaaggcgatttttatgtgcccttatacgat
tgtgaaatttttccgatggataaaaaaagtaatccgttggcatttttgccgtatgccaaa
gattacagtttcgaaagtttcgactgcccagtcaccgaacgtgcggctcatcgcgaagcg
atatggttaccgcattacttatttttgggaacggaaaaagatatggatgacattgttgcc
gcattcacaaagatcggtgaaaatttagacgaattggcgtaa

DBGET integrated database retrieval system