KEGG   Vigna angularis (adzuki bean): 108342452
Entry
108342452         CDS       T04660                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1-like
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
var  Vigna angularis (adzuki bean)
Brite
KEGG Orthology (KO) [BR:var00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108342452
Enzymes [BR:var01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     108342452
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 108342452
NCBI-ProteinID: XP_017435722
Position
9
AA seq 523 aa
MDFSDDIYIKQALVLKEVKHAFQKLVSEDSMESFHVIDIIQRLGIEHHFEEEIEAVLRKQ
HSVFSSHLNDFANGDKLYELALQFRLLRQRGHHVAADVFDSLKSNKREFRAKYGEDVKSL
IALHEATQLSIEGEDSLDDAGYLSRQLLHAWLKRHREHHEAIYVASTLEDPLHYGLSRFR
DTGVVLSDYYKTKKEWTCLEELAEINSCIVRMMNQNEIVQVYKWWNDLGMVKEEKFAKYQ
PLKWYIWPMACFTDPSFSDQRIELTKSISLIYIIDDIFDVHGTLDQLTLFRDAVNRWELA
DTEQLPDFMKMCLNVLFDMTNDFAEKVYKRHGLNPIDTLKRSWVRLLNAFMEEAHWLRSG
DLPRSEEYLNVGIVSTGVHVVLLHAFFLFDQSINMETVAVMDNFPQIVHSVAKILRLSDD
LEGFKKEDEKGVDGSYLDCYMNEHKHISAEDVQNHVCQLISSEWKRLNGQILIQNQLPTS
FTNFCLNAARMVPLMYHYTTNNPCLFILREQIKMMVNVDSDHM
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggatttctctgatgatatttatatcaaacaagctctggtgttgaaggaagttaagcat
gcattccagaaacttgtcagtgaggattccatggagagttttcatgtcattgacattatc
cagaggctcggcatcgaacaccattttgaagaggaaattgaagccgttcttcggaagcaa
cactccgtatttagcagtcatctcaatgattttgccaatggcgataaactttatgaactt
gcacttcaattccgtttacttagacaaagaggtcatcacgtagccgcagatgtatttgat
agcttgaagagtaataaaagagagttcagagctaaatatggtgaagatgtgaagagtctg
attgccctgcatgaggcaacccagctgagtatcgaaggagaagatagtcttgatgatgca
ggttatctgagccgtcaacttcttcatgcatggttgaaaagacatagagaacatcatgaa
gctatatatgttgctagcactcttgaggatccacttcactatggcttatcaagattcagg
gacacaggtgtagttctaagtgattattacaagaccaagaaagaatggacatgcttagag
gaacttgctgagataaactcctgcatagttagaatgatgaaccagaatgaaatcgttcaa
gtttacaaatggtggaatgatcttggaatggtgaaagaggagaagtttgccaagtatcaa
cctctgaaatggtacatttggcccatggcatgcttcacagatccaagcttttcagaccaa
agaattgaactcaccaaatccatctctctaatctacattatcgatgatatcttcgacgtt
catgggacattagaccaacttactttatttagagatgctgtcaatagatgggaattggcg
gatacagagcagcttccagacttcatgaaaatgtgtctaaatgttcttttcgacatgacc
aatgatttcgccgaaaaggtctataaaagacatggattaaacccaatagatacactaaaa
agatcgtgggtacgattgttgaatgctttcatggaagaggcacattggttgaggagtggt
gatttgccaaggtcagaggagtacttgaatgttggaattgtgagcacaggagtgcatgtg
gtgcttcttcatgcattcttcctcttcgatcagtctataaatatggaaactgttgctgtc
atggataactttccccaaattgttcactcagtggcaaaaattcttcgtctatctgatgat
ttggaaggattcaagaaggaagatgagaagggtgttgatgggtcataccttgattgctac
atgaatgagcacaagcacatttcagctgaagatgtccaaaaccatgtttgccaattgatt
tcatctgaatggaaacgtctcaatggacaaattctgatccaaaatcaattgccaacatcg
tttaccaatttctgcttgaatgctgctagaatggtacctttgatgtatcattacaccacc
aataatccatgtcttttcatcctgagagaacaaataaaaatgatggttaatgtggattct
gaccatatgtag

DBGET integrated database retrieval system