KEGG   Vigna angularis (adzuki bean): 108344639
Entry
108344639         CDS       T04660                                 

Symbol
AdGt-5
Name
(RefSeq) isoflavone 7-O-glucosyltransferase 1-like
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00943  Isoflavonoid biosynthesis
var01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    108344639 (AdGt-5)
Enzymes [BR:var01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     108344639 (AdGt-5)
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 108344639
NCBI-ProteinID: NP_001316765
UniProt: Q8S9A4
Position
10
AA seq 470 aa
MKDTIVLYPNIGRGHLVSMVELGKLILSHHPSLSITILILTPSPNATFTLASNSNAQYIA
AVSATIPAITFHSVPMAQLPLDTHSLPPHLISVDLSRHSTHNVALALQSLVKGSNIKALV
MDFLNFSNPKTLTENLTTNIPTFFYYTSAASSLVVLFHMSTTLPKQIKDEQFLLHFPGLP
AISTDDFPNESLDPLNYTNQIFSQIAEAMKGSSGIIINTCEAIEEKAIAVLNDDGTVPPL
FCVGPVISASYGEKDKGCLSWLESQPSQSVVLLCFGSMGLFSREQLKEMAIGLEKSQQRF
LWVVRTELECGDSVEEKPSLNELLPEGFLERTKEKGLVVRDWAPQREILSHDSVGGFVTH
CGWNSVLESVCEGVPMVAWPLYAEQKLNRVFMVQEMKVALALKEEKDGSVSGSELGERLK
ELMESDKGKEIRQKVFKMKLSAAEALGERGTSRVALNKLATLWETSYFTI
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctgtaccctaacattggtaggggtcacctagtgtccatggtg
gagctaggcaagctcattctatcccaccacccttctctttccatcaccatcctcatcctc
accccatctcccaacgccactttcaccctagccagcaactccaacgcccaatacatcgcc
gccgtctccgccaccatccccgccatcacctttcacagcgttcccatggcccaactcccc
ctcgacacccattccctaccccctcacctcatctccgtcgatctctcccgacacagcacc
cacaacgttgcccttgcactccaaagcctcgtcaaaggctccaacattaaagcccttgtc
atggacttcttaaacttcagcaaccccaaaactctcactgaaaatctcaccacaaacatc
cccactttcttctactacacatccgcagcctccagcctcgttgtgctttttcatatgtcc
accactctcccgaaacaaatcaaagatgaacagtttctacttcacttcccagggttgccc
gctatctccaccgatgactttccaaacgaatccctcgatcctttgaactacactaaccag
attttctctcagatagcggaagccatgaagggtagttctgggattataataaacacttgt
gaagcgattgaagagaaagccattgcagtgttgaacgacgatgggaccgtgcctccgttg
ttttgtgtgggccccgtgatttctgcatcatatggggaaaaggacaaaggatgtctgagt
tggctcgagtcgcaaccgagtcagagcgtggtgttgttgtgtttcggaagcatgggtttg
ttctcgagggagcagttgaaggagatggctattgggttagagaagagccagcaaaggttc
ttgtgggtggtgaggaccgagttggaatgtggtgactcggtggaggagaaaccgagtctg
aacgagttgttgccagaaggatttttggagaggacgaaggagaaggggttggtggtgcgg
gactgggccccacagagggagattctgagtcatgactcagtgggggggtttgtgactcac
tgcgggtggaactcggtgctggaatccgtgtgcgaaggggtgccaatggtggcgtggcca
ttgtacgccgagcagaagctgaatagggtgtttatggttcaggaaatgaaggttgctttg
gcgttgaaggaggagaaagatgggtcagtgagtgggagtgagttgggggagcgactgaag
gaactcatggaatcggacaaggggaaagaaattcgtcagaaggttttcaagatgaaactc
agtgctgcagaagcattgggtgaacgtggaacttcacgtgttgcgttgaataagttggct
acattatgggaaacgagttatttcactatttaa

DBGET integrated database retrieval system