KEGG   Vigna angularis (adzuki bean): 108344857
Entry
108344857         CDS       T04660                                 

Name
(RefSeq) isoflavone 7-O-glucosyltransferase 1-like
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00943  Isoflavonoid biosynthesis
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    108344857
Enzymes [BR:var01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     108344857
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 108344857
NCBI-ProteinID: XP_017438864
UniProt: A0A0L9VJJ6
Position
10
AA seq 467 aa
MKDTIVLYPNNGRGHLVSMVELGKLILSHHPSLSITILILTPSPNATFTLACNSNAQYIA
AVSATIPAITFHSVPMAQLPLDNPSLPPHLISLELSRHSTQNVALALQSLVKASNIKALV
MDFLNFSNPKILTENLTTNIPIFFYYTSAASSLVVLFHFPTTLPKQVKDQQFQLHFPGLP
AISTDVFPNETFDPLSYTNQIFRRIAEAMKRSSGIIINTSEAIEEKAIAVLNDNRMLPPL
FFVGPVISAPYGEEDKGCLSWLESQPSQSVVLLCFGSMGWFSRRQLMEMAIGLEKSEQRF
LWVVRTELEGGDSLEEKPSLDELLPEGFMDRTKEKGLVVRDWAPQREILSHDSVGGFVTH
CGWNSVLEAVCEGVPMVAWPLYSEQKLNRVFMVQEMKVALALKEEKDGLVSGSEFGERLK
ELMESDTGKEIRQRVFKMKLSAAEELGEGGTSRVALDRLAMLCKRVM
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctgtaccctaacaatggtaggggtcacctagtgtccatggtg
gagctaggcaagctcattctatcccaccacccttctctttccatcaccatcctcatcctc
accccatcccccaacgccactttcaccctagcctgcaactccaacgcccaatacatcgcc
gccgtctccgccaccatccccgctatcactttccacagcgttcccatggcccaactcccc
ctcgacaacccttccctcccccctcacctcatctccctcgaactctcccgacacagcaca
caaaacgttgcccttgcactccaaagcctcgtcaaagcctccaacatcaaagccctagtc
atggacttcttaaacttcagcaaccccaaaattctcacggaaaatctcaccacaaacatc
cccattttcttctactacacttccgcagcctccagcctcgttgtgctttttcatttcccc
actactctcccaaaacaagtcaaagaccaacaatttcaacttcacttcccagggttacct
gcaatatccacggatgtctttccaaacgaaaccttcgaccctttgagctacactaaccag
attttccgtcggatagcggaagccatgaagcgtagttctgggattataataaacacgtct
gaagcgattgaagagaaagccattgcagtgttgaacgacaataggatgctgccaccgttg
tttttcgtgggccctgttatttctgcaccatatggggaagaagacaaaggttgtctgagt
tggctcgagtcgcaaccgagtcagagcgtggtgttgctgtgtttcggaagcatgggatgg
ttctcgaggaggcagttgatggagatggctattgggttagagaagagcgagcaaaggttc
ttgtgggtggtgagaaccgagttggagggtggtgactcgctggaagagaagcccagtttg
gacgagttgttgcccgaagggtttatggatcggacgaaggagaaggggttggtggttcgg
gactgggctccacagagggagattctgagtcatgactcagtgggggggtttgtgactcac
tgcgggtggaactcggtgctggaagccgtgtgcgaaggggtgccaatggtggcttggcca
ttgtactcggagcagaagctgaatagggtgtttatggttcaggaaatgaaggtggctttg
gcgttgaaggaggagaaagatgggctggtgagtgggagtgaattcggggagcgattgaag
gaactcatggaatcggacacggggaaagagattcgtcagagggttttcaagatgaaactc
agtgctgcagaagaattgggtgaaggtggaacttcacgtgttgcgttagataggttggct
atgttatgtaagagagtaatgtaa

DBGET integrated database retrieval system