KEGG   Vibrio astriarenae: GT360_06845
Entry
GT360_06845       CDS       T06574                                 

Definition
(GenBank) uroporphyrinogen decarboxylase
  KO
K20549  3,6-anhydro-L-galactonate cycloisomerase [EC:5.5.1.25]
Organism
vas  Vibrio astriarenae
Brite
KEGG Orthology (KO) [BR:vas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GT360_06845
Enzymes [BR:vas01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.25  3,6-anhydro-L-galactonate cycloisomerase
     GT360_06845
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-ProteinID: QIA63248
UniProt: A0A7Z2T317
Position
1:1436204..1437292
AA seq 362 aa
MNTTIKDIKTRLFKIPLKEILSDAKHGDHDHFELITTTVTLEDGSQGTGYTYTGGKGGYS
IKAMLEHDIQPALIGKDATQIEEIYDFMEWHIHYVGRGGISTFAMSSVDIALWDLKGKRE
GLPLWKMAGGKNNTCKAYCGGIDLQFPLEKLLNNIRGYLESGFNAVKIKIGRENMQEDID
RIKAVRELIGPDITFMIDANYSLTVEQAITLSKAVEQYDITWFEEPTLPDDYKGFAEIAD
NTSIPLAMGENLHTIHEFGYAMDQAKLGYCQPDASNCGGITGWLKAAHLITENNIPVCTH
GMQELHVSLVSAFDTGWLEVHSFPIDEYTKRPLVVENFRAVASDEPGIGVEFDWDKIAQY
EV
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgaacacaacaattaaagacattaaaacaagactgtttaagatcccgttaaaggaaatt
ttgtccgacgctaaacatggtgaccatgaccattttgaactgatcacaacaacagtgaca
cttgaagatggttctcaaggtacggggtatacctacacaggtggtaaaggtggttattcg
attaaagccatgcttgagcacgatattcaaccagcgttaatcggaaaagatgcgactcag
attgaagagatttatgactttatggagtggcatatccactacgtggggcgtggtggtata
tcaacttttgcgatgtcttcggtagatatcgccctttgggatttgaaaggtaagcgtgaa
gggttaccgctatggaaaatggctggtggcaaaaacaacacgtgcaaagcgtactgtggt
ggtattgatcttcagttccctctagagaaactattgaacaatatccgtggttacctcgaa
agtggttttaatgccgttaagatcaagatcggccgtgaaaatatgcaagaagacatcgac
cgtattaaggcggttcgtgaactgattggtcctgacattaccttcatgatcgacgctaat
tattctttgacagtagagcaagccatcacgctttctaaagccgtcgagcaatatgatatt
acttggtttgaagaacccactcttcctgatgattataaaggtttcgcggagattgctgac
aacacttctatcccgttggctatgggtgaaaatcttcatactatccatgagtttggttac
gcgatggaccaagcaaagcttggttactgtcaaccagatgcctcgaactgtggtggtatt
accggttggttaaaagcggcgcatttaatcactgaaaataacatcccagtatgtacacac
ggcatgcaagagcttcacgtgagtttggtatcagcgtttgatacaggctggcttgaggta
catagttttccgatcgatgaatacaccaagcgtccattggtggttgaaaacttccgtgct
gttgcttcagatgaaccaggtatcggtgttgagtttgattgggataagatcgcacaatat
gaggtctag

DBGET integrated database retrieval system