Vibrio furnissii: vfu_A02924 Help Entry vfu_A02924        CDS       T01680                                  Name (GenBank) NTP pyrophosphohydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism vfu  Vibrio furnissii Brite KEGG Orthology (KO) [BR:vfu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:vfu03400]     vfu_A02924 Enzymes [BR:vfu01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      vfu_A02924 DNA repair and recombination proteins [BR:vfu03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     vfu_A02924  Prokaryotic type     vfu_A02924 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like Motif Other DBs NCBI-ProteinID:  ADT88036 Position 1:complement(3051272..3051670) Genome browser AA seq 132 aa AA seqDB search MKRIHIVAGIIFNQDKSQIFITKRPDNLHKGGFWEFPGGKVEVGESIEQAMARELDEEIG IEVTQQTPFQHLEYDYPEKSLTFDFILVTDFNHQPYGREGQQGEWVNIADLAHYTFPEAN VPVLERVLKEFA NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaaacgtattcacattgtggcaggcattatttttaatcaggacaagtcgcagatcttc atcaccaagcgtccggataacctgcataaaggtggtttctgggaatttcccggtggcaaa gtcgaagtgggcgagtcgattgaacaagcgatggcacgcgagctcgacgaagaaattggc attgaagtgacacaacaaacgccatttcaacatctggaatacgattaccccgagaagtcg ctgacgttcgacttcattttagtgaccgatttcaaccatcaaccctacggacgtgaaggt cagcagggtgagtgggtcaatatcgcagatcttgcgcactacaccttccccgaagccaat gtgccggtgcttgagcgcgtactgaaagagttcgcgtaa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (3) Pfam (3) All databases (5) Download RDF

DBGET integrated database retrieval system