KEGG   Viruses: 1258710
Entry
1258710           CDS       T40000                                 
Symbol
denA, T4p229
Name
(RefSeq) Escherichia phage T4; GIY-YIG nuclease family protein
  KO
K20841  Escherichia phage deoxyribonuclease II [EC:3.1.21.8]
Virus
2681598  Escherichia phage T4
SSDB
Motif
Pfam: GIY-YIG
Other DBs
NCBI-GeneID: 1258710
NCBI-ProteinID: NP_049840
RS: NC_000866
UniProt: P07059 A0A023ZVU6
Structure
Position
NC_000866:complement(137517..137951)
AA seq 144 aa
MGRKAHFIMKEIATEYSFIKYTELELDDNGSIKQLSIPNKYNVIYAIAINDELVYIGKTK
NLRKRINYYRTAINRKDKTSDSTKSALIHSALKEGSKVEFYARQCFNLSMTNELGTMTIA
TIDLEEPLFIKLFNPPWNIQHKKK
NT seq 435 nt   +upstreamnt  +downstreamnt
gtgggccgcaaggcccattttattatgaaagaaattgcaacagaatattcatttattaaa
tatactgagctagaattagacgacaatggaagtataaaacaattatctattccaaacaag
tataacgtaatttatgctattgctataaatgatgagcttgtttatattggaaaaactaaa
aatttacgtaaaagaataaactattatagaactgctattaaccgcaaagacaaaacgtct
gattctactaaatctgcattaattcattctgcgctaaaggaaggaagcaaagttgaattt
tacgcccgccaatgttttaatctttctatgacaaatgagttaggtacaatgacaatcgca
acgattgacttagaggagcctctattcattaaactgtttaacccgccttggaatattcaa
cacaagaaaaaatga

DBGET integrated database retrieval system