KEGG   Viruses: 1261340
Entry
1261340           CDS       T40000                                 
Symbol
sspC, SPBc2p172
Name
(RefSeq) Bacillus phage SPBc2; acid-soluble spore protein SspC
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Virus
2932878  Bacillus phage SPBc2
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-GeneID: 1261340
NCBI-ProteinID: NP_046724
RS: NC_001884
UniProt: Q77YX0
Position
NC_001884:complement(129990..130208)
AA seq 72 aa
MAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQNMGGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atggctcaacaaagtagatcaagatcaaacaacaataatgatttactaattcctcaagca
gcttcagctattgaacaaatgaaacttgaaatagcttctgagtttggtgttcaattaggc
gctgagactacatctcgtgcaaacggttcagttggtggagaaatcactaaacgtttagtt
cgcttagctcaacaaaacatgggcggtcaatttcattaa

DBGET integrated database retrieval system