KEGG   Viruses: 1449789
Entry
1449789           CDS       T40000                                 

Symbol
MSV129, MseVgp129
Name
(RefSeq) Melanoplus sanguinipes entomopoxvirus; ORF MSV129 putative membrane protein (vaccinia L5R), similar to SW:P07615
Taxonomy
TAX:83191
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Entomopoxvirinae; Deltaentomopoxvirus
Organism
vg  Viruses (Melanoplus sanguinipes entomopoxvirus)
SSDB
Motif
Pfam: Pox_L5 MscL
Other DBs
NCBI-GeneID: 1449789
NCBI-ProteinID: NP_048200
RS: NC_001993
UniProt: Q9YVW3
Position
NC_001993:complement(114944..115345)
AA seq 133 aa
MVLVKEKPNEKIINLNPTFILWDYEKYFSYGNFTIYIITLIEICFIIFLLFYFFQQELIF
IYNYFVGPQKTDDDIEQFNALDNTLQEIVNSSLYCNGDNLYYKYKGESRQALALNNEPIT
DCNNILNKYVTFN
NT seq 402 nt   +upstreamnt  +downstreamnt
atggtattagttaaagaaaagccaaatgaaaaaattattaatcttaatccaacttttata
ttatgggattatgaaaaatattttagttatggaaattttacaatatatattataacatta
atagaaatatgttttataatatttttattattttatttttttcaacaagaattaatattt
atttataattattttgtgggacctcaaaaaactgatgatgatattgaacaatttaatgca
ttagataatactttacaagaaatagttaatagtagtttatattgtaatggtgataatttg
tattataaatataaaggtgaatcaaggcaagctttagcattaaataatgaacctataact
gactgtaacaatattttgaataaatatgttacatttaattaa

DBGET integrated database retrieval system