KEGG   Viruses: 1486474
Entry
1486474           CDS       T40000                                 

Symbol
M5R, VARVgp077
Name
(RefSeq) Variola virus; hypothetical protein
  KO
K24608  Orthopoxvirus protein L5
Taxonomy
TAX:10255 [GN:T40082]
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Variola virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 1486474
NCBI-ProteinID: NP_042121
RS: NC_001611
UniProt: P0DOU1 P0DOU2 Q0N569 Q0NG61
Position
NC_001611:70715..71101
AA seq 128 aa
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMHKRK
IPDPIDRLRRANLACEDDKLMIYGLPWITTQTSALSINSKPIVYKDCAKLLRSINGSQPV
SLNDVLRR
NT seq 387 nt   +upstreamnt  +downstreamnt
atggagaatgttcctaatgtatactttaatcctgtgtttatagagcccacgtttaaacat
tctttattaagtgtttataaacacagattaatagttttatttgaagtatttgttgtattc
attctaatatatgtattttttagatctgaattaaatatgttcttcatgcataaacgaaaa
atacccgatcctattgatagattacgacgtgctaatctagcgtgtgaagacgataaatta
atgatctatggattaccatggataacaactcaaacatctgcattatcaataaatagtaaa
ccgatagtgtataaagattgtgcaaagcttttgcgatcaataaatggatcacaaccagta
tctcttaacgatgttcttcgcagatga

DBGET integrated database retrieval system