KEGG   Viruses: 1488457
Entry
1488457           CDS       T40000                                 

Gene name
GSHVgp4
Definition
(RefSeq) Ground squirrel hepatitis virus; hypothetical protein
  KO
K21854  HBV protein X
Taxonomy
TAX:10406
  Lineage
Viruses; dsDNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Blubervirales; Hepadnaviridae; Orthohepadnavirus
Organism
vg  Viruses (Ground squirrel hepatitis virus)
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 1488457
NCBI-ProteinID: NP_040996
RS: NC_001484
UniProt: P03168
Position
NC_001484:2884..3300
AA seq 138 aa
MAARLCCQLDSSRDVLLLRPLRGQPSGPSVSGTSAGSPSSAASAFSSGHQADIPVGRLPA
CFYSSAGPCCLGFTCADLRTMDSTVNFVPWHAKRQLGMMQKDFWTAYIRDQLLTLWEEGI
IDPRLKLFVLGGCRHKYM
NT seq 417 nt   +upstreamnt  +downstreamnt
atggctgctcgcctgtgttgccaactggattcttcgcgggacgtccttctgttacgtccc
ctccgcggacaacccagcggaccttccgtctcggggacttctgccggctctccgtcctct
gccgcttctgcgttttcgtccggtcaccaagcggatatccctgtgggccgcctccccgcc
tgtttctactcgtcggccggtccgtgttgcttgggcttcacctgtgcagacttgcgaacc
atggattccaccgtgaactttgtaccctggcatgctaagcgacagctgggcatgatgcaa
aaggacttttggactgcttatataagagatcaattattaactttatgggaggagggtatc
atcgatcctaggctgaaattatttgtattaggaggctgtaggcataaatacatgtga

DBGET integrated database retrieval system