KEGG   Viruses: 15042021
Entry
15042021          CDS       T40000                                 

Gene name
K202_gp3
Definition
(RefSeq) Long-fingered bat hepatitis B virus; X protein
  KO
K21854  HBV protein X
Taxonomy
  Lineage
Viruses; dsDNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Blubervirales; Hepadnaviridae; Orthohepadnavirus
Organism
vg  Viruses (Long-fingered bat hepatitis B virus)
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 15042021
NCBI-ProteinID: YP_007678001
RS: NC_020881
UniProt: M4Q3B7
Position
NC_020881:1378..1812
AA seq 144 aa
MAARLRCQLDASGNVVLLRPLCIESGGRPVARSARHSRRAAASPVPTVHGPHVTLRRLPI
CAASPAGPCALRFTCANFSGCMETTMNFVTWLGTRRRTGAKLNSGHWDMYFRESLMKEWE
EKGNDQRLYTYVSGGCRHKLLCTL
NT seq 435 nt   +upstreamnt  +downstreamnt
atggctgctcggctgcgttgccaactggatgcttcggggaacgtcgttctgcttcgtccc
ctctgcattgaatccggcggacgccccgtcgcgaggtctgctcggcattcccgtcgcgcc
gccgcctctcccgttccgaccgtccacgggccgcacgtcactcttcgccgtctccccatc
tgtgccgcctcacctgccggaccgtgtgcacttcgcttcacctgtgccaacttctcggga
tgcatggagaccaccatgaactttgtaacctggctgggcaccagaagaaggacgggagcc
aaactgaactctggacattgggacatgtactttagggaatcattaatgaaagaatgggag
gagaagggtaatgatcaacgattgtatacatatgtatctggaggctgtaggcataaattg
ctgtgtactctgtaa

DBGET integrated database retrieval system