KEGG   Viruses: 18158408
Entry
18158408          CDS       T40000                                 

Symbol
L5R, SQPV_0580
Name
(RefSeq) Squirrelpox virus; subunit of the poxvirus multiprotein entry-fusion complex
Taxonomy
TAX:240426
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Sciuripoxvirus
Organism
vg  Viruses (Squirrelpox virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 18158408
NCBI-ProteinID: YP_008658483
RS: NC_022563
UniProt: U3UBI0
Position
NC_022563:60494..60883
AA seq 129 aa
MSAPRPLILTPVFVEPTIKHTLLRETRYTGLVVLELIVAVLLLLIFFRTELGSVFSRAAS
APDPLERFRKARLECAADGGLMIAGLGARPRPALAGDGRPIRPADCAAVLRSVNNGPLAV
SLDDVLRGE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagcgcgccgcggccgctgatcctgacgccggtcttcgtggagccgaccatcaagcac
acgctcctgcgcgagacccggtacaccggcctggtggtcctggagctgatcgtggccgtg
ctgctgctcctcatcttcttccggaccgagctggggtccgtcttctcgcgcgcggccagc
gccccggaccccctggagcggttccggaaggcgcggctggagtgcgccgccgacgggggg
ctgatgatcgcgggcctgggcgcgcgtccgcgccccgcgctggccggggacgggcgcccc
atccggccggcggactgcgcggccgttttacgatcagtaaataatggaccactcgcagta
tctcttgacgatgttcttcgaggagagtaa

DBGET integrated database retrieval system