KEGG   Viruses: 19737424
Entry
19737424          CDS       T40000                                 

Gene name
HM84_gp3
Definition
(RefSeq) Roundleaf bat hepatitis B virus; X protein
  KO
K21854  HBV protein X
Taxonomy
  Lineage
Viruses; dsDNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Blubervirales; Hepadnaviridae; Orthohepadnavirus
Organism
vg  Viruses (Roundleaf bat hepatitis B virus)
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 19737424
NCBI-ProteinID: YP_009045993
RS: NC_024443
UniProt: U3M9Y2
Position
NC_024443:1220..1645
AA seq 141 aa
MAARLHCELDAARDVVLLRPLGVEPRGRPFPRPPRDPPRAAAAAVPPFHRSDLPVRRLPA
CAFSSAGPCVLRFTCADLQRHMETPLNFVTWQGARQRGHFLRTLDYWDWYIKQSLMNQWE
ELGLGERLNTYVLGGCRHKLK
NT seq 426 nt   +upstreamnt  +downstreamnt
atggctgctcggctgcactgcgaactggatgctgcgcgggacgtcgttctgctacgtccc
ctcggagttgaaccccgcggacgccccttcccgcggcctcctcgggatcctcctcgcgcc
gccgccgctgctgttccgcccttccaccggtcggacctccctgttcgccgtctccccgcc
tgcgccttttcatcggccggaccgtgtgtccttcgcttcacctgtgcggaccttcaaaga
cacatggagacccccctgaactttgtcacttggcagggggcccgtcaacgtggacacttt
ctaagaactttggactactgggactggtacattaaacaatcattaatgaatcaatgggag
gagctgggcttaggtgaaaggttaaatacatatgtattaggaggctgtaggcataaattg
aagtga

DBGET integrated database retrieval system