KEGG   Viruses: 19737434
Entry
19737434          CDS       T40000                                 

Gene name
HM83_gp3
Definition
(RefSeq) Tent-making bat hepatitis B virus; X protein
  KO
K21854  HBV protein X
Taxonomy
  Lineage
Viruses; dsDNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Blubervirales; Hepadnaviridae; Orthohepadnavirus
Organism
vg  Viruses (Tent-making bat hepatitis B virus)
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 19737434
NCBI-ProteinID: YP_009046001
RS: NC_024445
UniProt: U3M9X2
Position
NC_024445:1211..1618
AA seq 135 aa
MAARMLCHYDTARDILHLRPLRGQSSGPALAGTPAAQAASPPPPVSPDHRPDLSLRALPA
CATSDAGPCVLRFTSADLRRLATPVNICHSLTRRTRGHPWTLNNMDSWTWLMINREVGPR
IEYVLVAGGCRHKLQ
NT seq 408 nt   +upstreamnt  +downstreamnt
atggctgctcggatgctttgccactatgatactgcgcgggacatccttcatctacgtccc
ctccgaggccaatccagcggacctgccctcgcggggactcctgccgcacaggctgcgtcg
cctccacctccggtttcgcccgaccaccggccggacctctctctacgcgccctgcctgcc
tgtgccacctcggacgccggaccgtgtgtccttcgcttcacctctgcagacctacgaagg
ttggcaacccccgtgaacatctgtcactcattaacaagaagaacccgggggcatccgtgg
actttgaacaacatggactcgtggacttggttaatgattaacagggaggtgggacctagg
attgaatatgtattagttgctgggggctgcaggcataaattgcaatga

DBGET integrated database retrieval system