KEGG   Viruses: 23308115
Entry
23308115          CDS       T40000                                 

Gene name
HA, UJ99_s4gp1
Definition
(RefSeq) Influenza A virus (A/California/07/2009(H1N1)); hemagglutinin
  KO
K19251  Influenza A virus hemagglutinin
Taxonomy
TAX:641809
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H1N1 subtype
Organism
vg  Viruses (Influenza A virus)
SSDB
Motif
Pfam: Hemagglutinin HlyE Phage_HK97_TLTM EzrA SF-assemblin DUF1664 PriC FPP
Other DBs
NCBI-GeneID: 23308115
NCBI-ProteinID: YP_009118626
RS: NC_026433
UniProt: C3W627
Structure
PDB: 
5XHV

Position
NC_026433:1..1701
AA seq 566 aa
MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK
LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELRE
QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK
SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRXX
EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK
GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAIAGFIEGGWTG
MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR
IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
LVLVVSLGAISFWMCSNGSLQCRICI
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgaaggcaatactagtagttctgctatatacatttgcaaccgcaaatgcagacacatta
tgtataggttatcatgcgaacaattcaacagacactgtagacacagtactagaaaagaat
gtaacagtaacacactctgttaaccttctagaagacaagcataacgggaaactatgcaaa
ctaagaggggtagccccattgcatttgggtaaatgtaacattgctggctggatcctggga
aatccagagtgtgaatcactctccacagcaagctcatggtcctacattgtggaaacacct
agttcagacaatggaacgtgttacccaggagatttcatcgattatgaggagctaagagag
caattgagctcagtgtcatcatttgaaaggtttgagatattccccaagacaagttcatgg
cccaatcatgactcgaacaaaggtgtaacggcagcatgtcctcatgctggagcaaaaagc
ttctacaaaaatttaatatggctagttaaaaaaggaaattcatacccaaagctcagcaaa
tcctacattaatgataaagggaaagaagtcctcgtgctatggggcattcaccatccatct
actagtgctgaccaacaaagtctctatcagaatgcagatgcatatgtttttgtggggtca
tcaagatacagcaagaagttcaagccggaaatagcaataagacccaaagtgagggrtcra
gaagggagaatgaactattactggacactagtagagccgggagacaaaataacattcgaa
gcaactggaaatctagtggtaccgagatatgcattcgcaatggaaagaaatgctggatct
ggtattatcatttcagatacaccagtccacgattgcaatacaacttgtcaaacacccaag
ggtgctataaacaccagcctcccatttcagaatatacatccgatcacaattggaaaatgt
ccaaaatatgtaaaaagcacaaaattgagactggccacaggattgaggaatatcccgtct
attcaatctagaggcctatttggggccattgccggtttcattgaaggggggtggacaggg
atggtagatggatggtacggttatcaccatcaaaatgagcaggggtcaggatatgcagcc
gacctgaagagcacacagaatgccattgacgagattactaacaaagtaaattctgttatt
gaaaagatgaatacacagttcacagcagtaggtaaagagttcaaccacctggaaaaaaga
atagagaatttaaataaaaaagttgatgatggtttcctggacatttggacttacaatgcc
gaactgttggttctattggaaaatgaaagaactttggactaccacgattcaaatgtgaag
aacttatatgaaaaggtaagaagccagctaaaaaacaatgccaaggaaattggaaacggc
tgctttgaattttaccacaaatgcgataacacgtgcatggaaagtgtcaaaaatgggact
tatgactacccaaaatactcagaggaagcaaaattaaacagagaagaaatagatggggta
aagctggaatcaacaaggatttaccagattttggcgatctattcaactgtcgccagttca
ttggtactggtagtctccctgggggcaatcagtttctggatgtgctctaatgggtctcta
cagtgtagaatatgtatttaa

DBGET integrated database retrieval system